SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A8IXG2_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A8IXG2_9CALI
Domain Number 1 Region: 25-94
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2e-20
Family Caliciviridae-like VP 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A8IXG2_9CALI
Sequence length 94
Comment AC=A8IXG2; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Cor/Gunma/Dec-1/GII/2004/JP. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDASPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAP
GGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLXR
Download sequence
Identical sequences A8IXG2
A8IXG2_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]