SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A9UAW1_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A9UAW1_9CALI
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000000000000566
Family Caliciviridae-like VP 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A9UAW1_9CALI
Sequence length 84
Comment AC=A9UAW1; DE=SubName: Full=Capsid; Flags: Fragment; OS=Norovirus Hu/GII/175/JPN. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDATPSNDGAAGLVPEINNEAMALDPVAGAAIAAPLTGQQNIIDPWIMNNFVQAP
GGEFTVSPRNSPGEVLLNLELGPE
Download sequence
Identical sequences A9UAW1
A9UAW1_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]