SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0L0E9_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0L0E9_9CALI
Domain Number 1 Region: 19-88
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.44e-21
Family Caliciviridae-like VP 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0L0E9_9CALI
Sequence length 88
Comment AC=B0L0E9; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/NSW324J/2006/AUS. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
DATPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAPGGEFTV
SPRNAPGEILWSAPLGPDLNPYLSHLAR
Download sequence
Identical sequences B0L0E9 B0L0F3 G8HLZ8 Q460E1 Q460E3 Q460E4 Q460E5 Q460E6 Q460E7 Q460E8 Q460F1 Q460F2 Q460F4 Q460F6 Q460F7 Q460F8 Q460F9 Q460G0 Q460G1
B0L0E9_9CALI B0L0F3_9CALI Q460E1_9CALI Q460E3_9CALI Q460E4_9CALI Q460E5_9CALI Q460E6_9CALI Q460E7_9CALI Q460E8_9CALI Q460F1_9CALI Q460F2_9CALI Q460F4_9CALI Q460F6_9CALI Q460F7_9CALI Q460F8_9CALI Q460F9_9CALI Q460G0_9CALI Q460G1_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]