SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B3FRR2_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B3FRR2_9PICO
Domain Number 1 Region: 1834-2292
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.5e-112
Family RNA-dependent RNA-polymerase 0.000000036
Further Details:      
 
Domain Number 2 Region: 71-407
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.44e-101
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000476
Further Details:      
 
Domain Number 3 Region: 446-895
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.5e-81
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000148
Further Details:      
 
Domain Number 4 Region: 1631-1822
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.13e-45
Family Viral cysteine protease of trypsin fold 0.0053
Further Details:      
 
Weak hits

Sequence:  B3FRR2_9PICO
Domain Number - Region: 1211-1406
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000132
Family RecA protein-like (ATPase-domain) 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B3FRR2_9PICO
Sequence length 2293
Comment AC=B3FRR2; DE=SubName: Full=Polyprotein; OS=Human TMEV-like cardiovirus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Cardiovirus; unclassified Cardiovirus.
Sequence
MACKHGYPLMCPLCTALDKTSDGLFTLLFDNEWYPTDLLTVDLEDEVFYPDDPHMEWTDL
PLIQDIEMEPQGNSNSSDKNNSQSSGNEGVIINNYYSNQYQNSIDLSANANGVGKENSKP
QGQLMNILGSAADAFKNIAPLLMDQDTEEMTNLSDRVSSDTAGNTATNTQSTVGRLFAFG
TRHKGKHPASCADTATDKVLAAERYYTFKIATWSTQKAFDHVRIPFPHVLSGSKGGVFGS
TLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFDTSPYNATTEPTKAVPFQMDTQWQ
SGKLLGHSYESTTLQGLRPLALNHQNHWQWTVYPHQILNLRTNTTCDLEVPYVNICPTSS
WTQHANWVLVVAVLSPLQYSSGSSPNVDITVSVQPVKPVFNGLRHTVLEDQSPIPVTIRE
HAGTFYSTTPDTTVPIYGKTIATPSDYMCGEFDDLLSLCKIPTFLGNPTTDQRLPYISAN
NTVGDQPLATYQVTLSCSCMANSMLAAVSRNFNQYRGSLNYLFVFTGSAMAKGKFLISYT
PPGAGKPKDREQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYTTPSITSVDGWLSI
WQLTPLTYPANTPQSADILTLVSGGDDFTLRMPVTPSKYTPHGVDNAEKGKVANDNASAD
FVAVPIALPENQTKVAFFYDRAVLASALVNAQDLNSNFSLQDAANVMNNALLTPLPSNRL
DDSTYGLAEQHRWLSFPTDTKQTPPYKTKQDWNFLMFSPFTYYKCDLEVTLSLNSSDAIG
SVVRYTPCGAPVDLSEQTIPYTPSLSDTRDPHMWVVGPGATNQISFVIPYTSPLSVLPAV
WFNGFSDFDNKTRFGVAPNADFGRLFVQGADRFSVHYRYKKMRVFCPRPTVFFPWPANSV
SKIKSVRPTPVLELQNPISMYRVDLFINFSDEIIQFTYKVHGRTVCQYEIPGFGLSRSGR
LLVCMGEKPCQLPVSTPKCFYHIVFTGSRNSFGVSIYKARYRPWKQPLHDELYDYGFSTF
TDFFKAVRDYHASYYKQRLQHDIETNPGPVQSVFQLQGGVLTKSQAPMSGLQSMLLRAIG
IEADCTEFTRAVNLITDLCNTWESAKTTLSSPEFWTKMVMRIVKMVAASVLYLHNPDLTT
TVCLSLMAGIDVLTNDSVFNWLSTKLSKFFHTPAPPIVPLLQQQSPVREANDNFNLAKNI
EWAIKTIKRIVEWITSWFKQEETSPQAKLDKMLADFPEHCSSILAMRNGRKAYTDCAGAF
KYFEQLYNLAVQCKRIPLATLCEKFKNKHDHAVARPEPVVVVLRGNAGQGKSVTSQIIAQ
AVSKLLFGRQSVYSLPPDSDYLDGYENQYSVIMDDLGQNPDGEDFKVFCQMVSSTNFLPN
MAHLEKKGTPFTSNFIIATTNLPKFRPVTVAHYPAVDRRITFDLTVEAGDECITHNGMLD
VEKAFEETPGKPQLDCFNTDCRLLHKRGVRFICNRTKNIYNLQQVVKMVKNTIDNKVENL
KKMNTLVAQSPGNDMDYVLTCLRQTNAALQDQIDELQEAFNQAQERQNFLSDWLKVSAIV
FASIASLSAVCKLVSRFKNLVCPAPVQIQLSEGEQAAYSGGKKGEKQTLQILDVQGGGKI
VAQAGNPIMDYEVNIAKNMVTPITFFYADKAQVTQSCLLVKGHLFVVNRHVAETDWCAFE
LRGTRHERDSVQMRSINKSGMEVDLTFVKVVKGPLFKDNSRKFCSKDDDFPARNETVTGI
MNTGVPFVFTGKFLVGNQPVNTTTGACFNHCIHYRATTHRGWCGSALICHVNGKKAVYAM
HSAGGGGMAAATIITQEMIEAAEKALDCLIPQGAIVEIGIDTVVHVPRKTKLRRTVAHPC
FQPKFEPAVLSRYDPRTTKDVDQVAFSKHTTNLEELPSVFSMVAKEYANRVFTTIGKENQ
ILTPEQAILGLPGMDPMEKDTSPGLPYTQQGLKRAQLVNFEQGTMVQHLKEAHTKLTKGN
YEDILYQSFLKDEIRPIEKIHEAKTRIVDVPPFHHCIWGRQLLGRFASRFQTNPGLDLGS
AIGTDPDTDWTAFAFQLLQYKYVYDVDYSNFDASHSTAMFEILIENFFTTENGFDERIGD
YLRSLAVSRHAFEERRVLVKGGLPSGCAATSMLNTIINNIVIRAALHLTYSNFEFDDIKV
LSYGDDLLIATNYQINFNLVKQRLAPFNYKITPANKTVEFPEISNLYEVTFLKRKFVRHN
SCLFKPQMDTENLKAMVSYCRPGTLKEKLNSIALLAVHSGKSVYDEIFDPFRRIGIIVPE
HSTMLYRWLNLFR
Download sequence
Identical sequences B3FRR2
B3FRR2_9PICO YP_001949875.1.20152 gi|189418894|ref|YP_001949875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]