SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B4YYP2_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B4YYP2_9PICO
Domain Number 1 Region: 1845-2302
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.92e-111
Family RNA-dependent RNA-polymerase 0.0000000203
Further Details:      
 
Domain Number 2 Region: 76-409
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.87e-103
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000041
Further Details:      
 
Domain Number 3 Region: 449-902
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.41e-83
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000216
Further Details:      
 
Domain Number 4 Region: 1651-1832
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-41
Family Viral cysteine protease of trypsin fold 0.0061
Further Details:      
 
Weak hits

Sequence:  B4YYP2_9PICO
Domain Number - Region: 1270-1438
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000133
Family RecA protein-like (ATPase-domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B4YYP2_9PICO
Sequence length 2303
Comment AC=B4YYP2; DE=SubName: Full=Polyprotein; OS=Theiler's encephalomyelitis virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Cardiovirus.
Sequence
MACKHGYPDVCPICTAIDATPGFEYLLMADGEWFPTDLLCVDLDDDVFWPSHSSNQSQTM
EWSDLPLVRDIVMEPQGNSSSSDKSNSQSSGNEGVIINNFYSNQYQNSIDLSASGGNAGD
APQTNGQLSNILGGAANAFATMAPLLLDQNTEEMENLSDRVASDKAGNSATNTQSTVGRL
CGYGEAHHGEHPASCADTATDKVLAAERYYTIDLASWTTSQEAFSHIRIPLPHVLAGEDG
GVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKAGVMEPTDPFTM
DTEWRTPQGAPTGYRYDGQTGFFAMNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNVAP
SSSWAQHANWTLVVAVLSPLQYASGSSPDVQITASIQPVNPVFNGLRHETVIAQSPIAVT
VREHQGCFYSTNPDTTVPIYGKTISTPSDYMCGEFSDLLELCKLPTFLGNPNSNNKRYPY
FSATNSVPTTSLVNYQVALSCSCMCNSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFL
IAYTPPGAGKPASRDQAMQATYAIWDLGLNSSFNFTAPFISPTHYRQTSYTSATITSVDG
WVTVWQLTPLTYPSGTPTNSDILTFVSAGDDFTLRMPISPTKWVPQGIDNAEKGKVSNDD
ASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNLASTFVYQEKDLRLNCLLLTPLP
SFCPDSNSGPLKTKAPVQWRWVRSSGTNGTNFPLMTKQDYAFLCFSPFTYYKCDLEVTVS
ALGTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHVWLVGAGNSQISFVVPYNSP
LSVLPAAWFNGWSDFANTTDFGVAPNADFGRLWIQGNTAASVRIRYKKMKVFCPRPTLFF
PWPPAATTKINADNPVPILELENPAAFYRIDLFITFTDEFITFDYKVHGRPVLTFRIPGF
GLTPAGRMLVCMGEKPAHGPFTSSKSLYHVIFTSTHNSFSFTVYKGRYRSWKKPIHDELV
DRGYTTFGEFFKAVRGYHADYYKQRLIYDVETNPGPVQSVFQPQGAVLTKSLAPQTGIQN
LLLRLLGIDGDCSEVSKAITVITDLVAAWKRPKTTLVSPEFWTKLILRTTKFIAASVLYL
HNPDLTATICLSLMTGVDILTGDSVFDWLKNKLSSFFRTPPPPCPPVLQPQGPLREANEG
FTFAKNIEWATKTIKAIVDWLTSWFKQEEDHPQSKLDKLLMDFSDHCKNIMDMRNGRKAY
CECTASFKYFDDLYNLAVTCKRIPLASLCEKFKNRHDHSVTRPEPVVVVLRGAAGQGKSV
TSQIIAQSVSKMAFGRQSVYSMPPDSEYFDGYENQFSVIMDDLGQNPDGEDFTVFCQMVS
STNFLPNMAHLERKGTPFTSSFIVATTNLPKFRPVTVAHYPAVDRRITFDFTVTAGPHCK
TPNGMLDIEKAFDEIPGSKPQLSCFSADCPLLHKRGVMFTCNRTQTVYNLQQVVKMVNDT
ITRKTENVKKMNSLVAQSPPDWEQFENILTCLRQNNAALQDQLDELQEAFAQARERSDFL
SDWLKVSAIIFAGIASLSAVIKLVSKCKESIWPTPVRVELSEGEQAVYAGRARVQKQALQ
VLNIQGGGKVLAQAGNPVMDFDLFCARNMGAPITFYYPDKAEVTQSCLLLRAHLFVVNRH
VAETEWTAFKLRDVRHECDTVVMRSVNRSGAETDLTFMKVTKGPLFKDNVNKFCSDKDDF
PARNDTVTGIMNTGLAFVYSGNFLIGNQPVNTPTGACFNHCLHYRAQTRRGWCGSAVICN
VNGKKAVYGMHSAGGGGLAAATIITRELIEAAEKSMSALEPQGAIVDISTGSVVHVPRKT
KLRRTVAHDVFQPKFEPAVLSRYDPRTDKDVDVEAFSKHTTNLESLPPIFDIVCGEYANR
VFTVLGKDNGLLTIEQAVLGLPGMDPMEKDTSPGLPYTQQGLRRTDLLDFATARMTTQLD
YDHSKLVLGIYDDVVYQSFLKDEIRPIEKIHEAKTRIVDVPPFAHCIWGRQLLGRFASRF
QTTPGLELGSAIGTDPNVDWTRYAAELSNFNYVYDVDYSNFDASHSTAMFECLIKNFFTE
QNGFDKRNAEYLRSLAVSRHAYEDRRVLIRGGLPSGCAATSMLNTIMNNVIIRAALYLTY
SNFEFDDGKVLSYGDDLLIGTNFQIDFNLVKERLTPFGYKITPANKTTTFPMTSHLQDVT
FLKRRFVRFNSYLFRPQMDAVNLKAMVSYCKPGTLKEKLKSIALLAVHSGPDIYDEIFLP
FRNVGIVVPTYDSMLYRWLSLFR
Download sequence
Identical sequences B4YYP2
B4YYP2_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]