SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B5SXL8_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B5SXL8_9PICO
Domain Number 1 Region: 1849-2306
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.51e-115
Family RNA-dependent RNA-polymerase 0.0000000375
Further Details:      
 
Domain Number 2 Region: 77-410
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.64e-105
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000236
Further Details:      
 
Domain Number 3 Region: 450-906
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.94e-83
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000263
Further Details:      
 
Domain Number 4 Region: 1645-1835
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.07e-44
Family Viral cysteine protease of trypsin fold 0.0058
Further Details:      
 
Weak hits

Sequence:  B5SXL8_9PICO
Domain Number - Region: 1277-1439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000136
Family RecA protein-like (ATPase-domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B5SXL8_9PICO
Sequence length 2307
Comment AC=B5SXL8; DE=SubName: Full=Polyprotein; GN=Name=L; OS=Rat theilovirus 1. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Cardiovirus.
Sequence
MMACIHGYPSVCPICTAIDKSSDGMYLLLADNEWFPADLLTMDLDDDVFWPNDKSNVSET
MDWTDLPFILDTVMEPQGNSTSSDKSNSQSSGNEGVIINNFYSNQYQNSIDLSANGGNAG
GAPKTEGQLGNILGNAANAFSTMAPLLLDQNTEEMENLSDRVDSDKAGNSAVNTQSSVGR
LCGYGMHHKGKHPASCADTATDKVLSAERYYTIDLATWTTTLGTFSHIRIPLPHVLAGED
GGVFGSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFYTGHTPTSGTTEPTTPFT
MDSSWQTPQQAPVGFRYDGRNGYFALNHQNYWQWMVYPHQILNLRTNTSVDLEVPFTNIA
PTSSWTQHANWTLVVAVLTPLQYAAGSATDVQITASIQPVKPVFNGLRHEAVVPQSPIPV
TVREHKGTFYSTNPDTTVPIYGKTIATPSDYMCGEFSDLVELCKLPTFLGNPANTSPPGG
RYPYFSATNSVPTTALASYQVALSCSGMSNSMLAAVARNFNQYRGSLNFLFVFTGTAMTK
GKFLIAYTPPGAGKPTTREQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYTSTSIT
SVDGWLTVWQLTPLTYPANTPPNADILTLVSAGDDFTLRMPISPTKWNPQGVDNAEKGKV
SNDDATVDFVAEPVKFPDNQTKVSFFYDRSVPLGLLRPAQGAEQDFVYAANDSRANSILL
TPLPSYAPDSTSGPTETQAPVQWRWLRGTSDGSTTFPLMTKQDYAFLLFSPFTYYKADLE
VTLSATSNSNVATVVRWAPTGAPADIGRQLSGYTPSIGDTRDPHMWLVGAGNSQTSFVVP
YNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTAVAVRIRYKKMKVFCPRP
TLFFPWPSATTTRIHADTPVSVMELQNPFSFYRVDLFITFTDELITFDYKVHGRSVFQYQ
VPGLGLTCAGRMLVCMGQMPNHAPFSTVRHLYHVVFTGSRNSFGVVIYLKRHRPWKKPLH
EELHDYGFECFSDFFKHVREYHAAYYKQRLMHDVETNPGPPVQSVFRPQGGVLTKSQAPM
SGIQNLLLRALGIDADHGEFTRAVTMITDLCNTWEKAKNTLVSPEFWTVLIMKTVKFIAA
SVLYLHNPDLTATICLSLMTGVDVLTNESIFNWLSNKLSKLFHTPPPPASPLLQAQSPLR
EANDGFNLAKNIEWAIKTVQKIVDWLMSWFKQEETHPQAKLDKMLADFPEHCASILAMRN
GRKAYTDCAGAFKYFEDLYNLAVQCKRIPLATLCEKFKNKHDHAVARPEPVVVVLRGDAG
QGKSVTSQIIAQAVSKLAFGRQSVYSIPPDSDYLDGYENQFSVIMDDLGQNPDGEDFKVF
CQMVSSTNFLPNMAHLEKKGTPFTSNFIVATTNLPKFRPVTVAHYPAVDRRITFDLTVEA
GPACKTPTGMLDVEKAFQEIPGEPQLDCFSSDCALLHKRGVQFICNRTRKIYNLQQIVKM
VKDTIDNKVANLKKMNTLVAQSPNNGNDMEHIITCLRQNNAALQDQIDELQEAFAQAQER
QNFLSDWMKVSAIIFAGIASLSAVCKLVGRLKNLIWPSPVRVELSEGEQAAYAGAKRGAK
QALQVLDLQGGGRIIAQAGNPVMDYEVCVAKNMVAPITFYYADKAQVTQSCLLVKGHLLV
VNRHVAETDWVSFELRDVRHERDTVTLRSVNRSGMEVDLTFIKVTKGPLFKDNTKKFCSN
KDDFPQKNETVTGIMNTGLPFVFNGKFIIGNHPVNTTTGATFNHCLHYRANTRRGWCGSA
VICQVNGKKAVYGMHSAGGGGLAAATIITQELVEAAEQNMDRLVPQGAIMEIGTGSVVHV
PRKTKLRRTVAHEIFLPKFEPAVLSRYDPRTEKDVDQVAFSKHTTNMEELPAIFNMVAKE
YANRVFTKLGKENQLLTTQQAILGLPGMDPMEKDTSPGLPYTQQGLRRTDLVNFETGKMD
HNLDYAHSKLMLGHYEDVVYQSFLKDEIRPIEKIHEAKTRIVDVPPFHHCIWGRQLLGRF
ASRFQTNPGLDLGSAIGTDPDVDWTVFAHQLAEFKYVYDVDYSNFDASHSTAIFEILIQE
FFTPQNGFDPRIGEYLRSLAVSRHAYEDRRVLIRGGLPSGCAATSMINTIINNIVIRAAL
YMTYANFEFDDIKVLSYGDDLLIATNYEINFNLVKERLAPFNYKITPANKTSTFPQTSHL
QDVVFLKRRFVQFNSFLFRPQMETENLKAMVSYCRPGVLKEKLMSIALLAVHSGPDVYDE
IFMPFRRIGVVVPEYSTMLYRWLNLFR
Download sequence
Identical sequences B5SXL8
B5SXL8_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]