SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B6E956_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B6E956_9CALI
Domain Number 1 Region: 56-171
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.67e-32
Family Caliciviridae-like VP 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B6E956_9CALI
Sequence length 171
Comment AC=B6E956; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Sapovirus Hu/Tula/6218/2005/RUS. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Sapovirus.
Sequence
APDPECPTEGAPKLVFEMEGNGSQLPTNQNGGHVGQDVDPPGATGPTTSHVVVSNPEQPN
GPAQRLEMAVATGSIQSNVPEAIRNCFAVCRTFAWNDRMPTGTFLGSLSLHPNINPYTSH
LSGMWAGWGGSFEARISISGSGMFAGRIIASVIPPGVDPTSIRDPGVLPHA
Download sequence
Identical sequences B6E956
B6E956_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]