SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9UGD5_9HIV1 from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9UGD5_9HIV1
Domain Number 1 Region: 58-183
Classification Level Classification E-value
Superfamily Virus ectodomain 1.71e-58
Family Virus ectodomain 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B9UGD5_9HIV1
Sequence length 225
Comment AC=B9UGD5; DE=SubName: Full=Envelope glycoprotein; Flags: Fragment; GN=Name=env; OS=Human immunodeficiency virus 1. OC=Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae; OC=Lentivirus; Primate lentivirus group.
Sequence
LYKYKVVKIEPLGVAPSHAKRRVVEREKRAVGLGAFFLGFLGAAGSTMGAASITLTVQAR
QLLSGIVQQQSNLLKAIEAQQQMLRLTVWGIKQLQARVLALERYLKDQQLLGIWGCSGKI
ICTTRVPWNSSWSNKTYDEIWGNMTWLQWDKEISNYTNIIYGLIEESQHQQEKNEQDLLA
LDKWASLWNWFDITNWLWYIRIFIMVVGGLIGLRIVFAVLTIINR
Download sequence
Identical sequences B9UGD5
B9UGD5_9HIV1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]