SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9W3X1_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9W3X1_9PICO
Domain Number 1 Region: 1715-2175
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.88e-110
Family RNA-dependent RNA-polymerase 0.0000196
Further Details:      
 
Domain Number 2 Region: 33-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.03e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0041
Further Details:      
 
Domain Number 3 Region: 282-539
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.5e-49
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0048
Further Details:      
 
Domain Number 4 Region: 560-761
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.74e-28
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.024
Further Details:      
 
Domain Number 5 Region: 1514-1700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.05e-28
Family Viral cysteine protease of trypsin fold 0.019
Further Details:      
 
Domain Number 6 Region: 1146-1305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000172
Family RecA protein-like (ATPase-domain) 0.079
Further Details:      
 
Weak hits

Sequence:  B9W3X1_9PICO
Domain Number - Region: 925-1042,1098-1149,1367-1403
Classification Level Classification E-value
Superfamily ARM repeat 0.0449
Family PBS lyase HEAT-like repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9W3X1_9PICO
Sequence length 2179
Comment AC=B9W3X1; DE=SubName: Full=Polyprotein; GN=Name=polyprotein; OS=Human parechovirus 1. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKNIADMATGVVSSVDSTINAVNEKVENVGNEIGGNLLTKVADDASNVLGPNCYATT
AEPENKDVVQATTTVNTTNLTQHPSAPTMPFTPDFSNVDTFHSMAYDITTGEKNPSKLVR
LETHEWTPTWARGYQITHVELPKVFWDKNSKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVVTYDSKLEFGAFTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLKVYVWTPLSIPSGSATQVDVTILGSLLQLDFQNPRVFGQDVGIYDNAPTRKQNIKKI
LTMSTKYKWTRQKIDIAEGPGSMNMANVLSTTAAQSIALVGERAFYDPRTAGSKSRFDDL
VKISQLFSVMCDSTTPSANHGIDAKGYFKWSSTTAPQSVVHRNIVYLKLFPNLNVFVNSY
SYFRGSIVLRLSVYASTFNRGRLRMGFFPNATEDSTSEIDNAIYTICDLGSDNSFEITIP
YSFSTWMRKTDGHPIGLFQIEVLNRLTYNSSSPNEVYCIVQGKMGQDARFFCPTGSVVTF
QNSWGSQMDLTDPLCLKESAEECKQTISPNELGLTSAQDDGPLGDNKPNYFLNFKSMNVD
IFTVSHTKVDNLFGRAWFYQEHTFTNEGQWRVNLEFPKQGHGSLSLLFAYFTGELNIHVL
FLAGKGFLRIAHTYDTSTNRVNFLSSNGVITIPAGEQMTLSAPYYSNKPLRTVRDSNSLG
YLMCKPFLTGTTTGKIEVYLSLRCPNFFFPLPAPKVTTGRALRGDLANFSDQSPYDQQPQ
SQVMKLAYLDRGFYKHYGIIVDDYVYQLDSDDIFKTALTGKAKFTKTKLTQDWVIEEECE
LDYFRVKYLESSVNSEHIFSVDSNCETIAKDIFGTQTLSQHQAIGLIGTILLTAGLMSTI
KTPVNVTTIKEFFNHAMDGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILVRILC
YMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAESMSN
TDDEEIKEQICDTVKYTKSILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSVFKP
SMESKAIQWLERNKEHVCAILDYASDIIVESKDQTKMKTQEFYQKYTDCLAKFKPIMAIC
FRSCHNSISNTVYRLFQELARIPSRISTQNDLIRVEPIGVWIQGEPGQGKSFLTHTLSRQ
LQKSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFIVPMA
HLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKVGKLNVSQ
AMSTMATGECWEVSKNGRDWETLKLKDLVQKITEDYQERQNNYNCWKQQLENQTLDDLDD
AVSYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFATKVASQTRKAAKDV
VEWFSSKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEDSKDERAYNPTLPVV
KPKGTFPVTQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHGHSIK
YLEQEEELTLHYKNKVFPIENPSVTQVTLGGKPMDLALLKCKLPFRFKKNSKYYTNKIGT
ESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGN
FKILGMHIAGNGEMGVAIPFDFLRNDMSDQGIVTEVTPIQPMYINTKTQIHKSPVYGAVE
VKMGPAVLNKSDPRLEEPVECLIKKSAAKYRVNRFQVDNELWQGVKACVKSKFREIFGIN
GIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSISPMLEKLVQEKFHA
LLKGSQITTIFNTCFKDELRKLDKISAGKTRCIEACEVDYCIVYRMIMMEIYDKIYQTPC
YYSGLAVGINPYKDWHFMINAINDFNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDSRNLV
MQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDCLPI
VYGDDVILSLDKEIDPEKLQSIMADSFGAEVTGSRKDEPPSLKPRLEVEFLKRKPGYFPE
STFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYLHYIKILDPYLKEWN
ITVDDYDVVIAKLMPMVFD
Download sequence
Identical sequences B9W3X1
B9W3X1_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]