SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B9X061_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B9X061_9CALI
Domain Number 1 Region: 54-245
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.62e-61
Family Caliciviridae-like VP 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B9X061_9CALI
Sequence length 246
Comment AC=B9X061; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Sapovirus sewage/Toyama/Feb/2007/JP. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Sapovirus.
Sequence
VPDPVGHTEGTHKIVFEMEGNGSNPEPKQSNNPMVVDPPGTTGPTTSHVVVANPEQPNGA
AQRLELAVATGAIQSNVPEAIRNCFAVFRTFAWNDRMPTGTFLGSISLHPNINPYTAHLS
GMWAGWGGSFEVRLSISGSGVFAGRIIASVIPPGVDPSSIRDPGVLPHAFVDARITEPVS
FMIPDVRAVDYHRMDGAEPTCSLGFWVYQPLLNPFSTTAVSTCWVSVETKPGGDFDFCLL
RPPGQQ
Download sequence
Identical sequences B9X061 B9X067 B9X070
B9X061_9CALI B9X067_9CALI B9X070_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]