SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C1K286_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C1K286_9CALI
Domain Number 1 Region: 25-94
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.19e-20
Family Caliciviridae-like VP 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C1K286_9CALI
Sequence length 94
Comment AC=C1K286; DE=SubName: Full=Capsid; Flags: Fragment; OS=Norovirus Hu/GII/R3U-200607/2007/SGP. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASSDAAPSNDGAAGLVPEANNETMALEPVAGASIAAPLTGQNNIIDPWIRLNFVQAP
NGEFTVSPRNSPGEILLNLELGPELNPFLSHLAR
Download sequence
Identical sequences C1K286
C1K286_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]