SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8CBE3_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8CBE3_9CALI
Domain Number 1 Region: 30-78
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000000217
Family Caliciviridae-like VP 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C8CBE3_9CALI
Sequence length 78
Comment AC=C8CBE3; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/GI/Beijing/60/2007. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MMMASKDATPSADGATGAGQLVPEVNTADPIPIDPVAGSSTALATAGQVNLIDPWIINNF
VQAPQGEFTISPNNTPGD
Download sequence
Identical sequences C8CBE3
C8CBE3_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]