SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C8YX82_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C8YX82_9PICO
Domain Number 1 Region: 1718-2175
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.43e-110
Family RNA-dependent RNA-polymerase 0.0000241
Further Details:      
 
Domain Number 2 Region: 283-539
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 6.54e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0052
Further Details:      
 
Domain Number 3 Region: 33-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.4e-47
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0049
Further Details:      
 
Domain Number 4 Region: 556-757
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.87e-28
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.038
Further Details:      
 
Domain Number 5 Region: 1514-1700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.23e-28
Family Viral cysteine protease of trypsin fold 0.027
Further Details:      
 
Domain Number 6 Region: 1149-1317
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000456
Family Extended AAA-ATPase domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C8YX82_9PICO
Sequence length 2179
Comment AC=C8YX82; DE=SubName: Full=Polyprotein; OS=Human parechovirus 1. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKNIADMATGVVSSVDSTINAVNEKVENIGNEVGGNLLTKVADDASNILGPNCFATT
AEPENKNVVQATTTVNTTNLTQHPSAPTMPFSPDFSNVDNFHSMAYDITTGDKNPSKLVR
LETHEWTPSWARGHQITHVELPRVFWDNQEKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVVTYDSKLEFGAFTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLKGYVWTPLSIPSGSATQVDVTILGSLLQLDFQNPRVFGQDVGIYDNAPTRKQNLKKI
LTMSTKYKWTRQKIDIAEGPGSMNMANVLSTTAAQSIALVGERAFYDPRTAGSKSRFDDL
VKISQLFSVMSDSTTPSANHGIDAKGYFKWSATTAPQSVVHRNIVYLKLFPNLNVFVNSY
SYFRGSIVLRLSVYASTFNRGRLRMGFFPNATEDSTSEIDNAIYTICDLGSDNSFEITIP
YSFSTWMRKTDGHAIGLFQIEVLNRLTYNSSSPNEVYCIVQGKMGQDARFFCPTGSVVTF
QNSWGSQMDLTDPLCLEESAEECKQTISPNELGLTSAQDDGPLGDNKPNYFLNFKSMNVD
IFTVSHTKVDNLFGRAWFYQEHTFTDEGQWRVNLEFPKQGHGSLSLLFAYFTGELNIHVL
FLAEKGFLRVAHTYDTSENRVNFLSSNGVITIPAGEQMTLSAPYYSNKPLRTVRDSNSLG
YLMCKPFLTGTTTGKIEVYLSLRCPNFFFPLPAPKVTTSRALRGDLANFSDQSPYDQQPQ
SQVMKLAYLDRGFYEHYGIIVGDYVYQLDSDDIFKTALTGKARFTRTKLTPDWVIEEECE
LDYFRVKYLEPSVNSEHIFSVDHNCETIAKDIFGTHTLSQHQAIGLIGTILLTAGLMSTI
KTPVNATTIKEFFNHAVEGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILVRILC
YMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAESMSN
TDDEEIKEQICDTVKYTKSILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSVFKP
SMESKAIQWLERNKEHVCAILDYASDIIVESKDQTKMKSQEFYQKYTDCLSKFKPIMAIC
FRSCHNSISNTVYRLFQELARIPSRISTQNDLIRVEPIGVWIQGEPGQGKSFLTHTLSRQ
LQRSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFIVPMA
HLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKSGKLNVSQ
AMSTMATGECWEVSKNGRDWETLKLQDLVKKITEDYEERQRNYNCWKQQLENQTLDDLDD
AVSYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFATKVANKTRKAAKEV
VDWFSSKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEDSKDERAYNPTLPAT
KPKGTFPVTQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHGHSIK
YLEQEEDLTLHYKNKVFPIENPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGT
ESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGN
FKILGMHIAGNGEMGVAVPFNFLKNDMSDQGIVTEVIPIQPMYINTKTQINKSPVYGAVE
VKMGPAVLSKSDTRLVEPVDCLIKKSASKYRVNKFQVNNELWQGVKACVKSKFREIFGVN
GIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLDPFSVSPMLEKLVQDKFRN
LLKGNQITTIFNTCLKDELRKLDKIATGKTRCIEACEVDYCIVYRMIMMEIYDKIYQTPC
YYSGLAVGINPYKDWHFMINALNEYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDSPDLV
MQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLIRPGIDCLPI
VYGDDVILSLDKEIEPEKLQSIMAESFGAEVTGSRKDEPPSLKPRMEVEFLKRKPGYFPE
STFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLLELCLHGKDIYQHYIKILDPYLKEWN
ITVDDYDVVIAKLMPMVFD
Download sequence
Identical sequences C8YX82
C8YX82_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]