SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C9D733_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C9D733_9CALI
Domain Number 1 Region: 1-38
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.00000377
Family Caliciviridae-like VP 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C9D733_9CALI
Sequence length 44
Comment AC=C9D733; DE=SubName: Full=Capsid; Flags: Fragment; GN=Name=VP1; OS=Norovirus Hu/GII/TSPC19/2006/Botswana. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
SDVALLRFVNPDTGRVLFECKLHKSGYVTVAHTGQHDLVIPPNG
Download sequence
Identical sequences C9D732 C9D733
C9D732_9CALI C9D733_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]