SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D1M914_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D1M914_9PICO
Domain Number 1 Region: 33-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.63e-51
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0021
Further Details:      
 
Domain Number 2 Region: 280-538
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.36e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0047
Further Details:      
 
Domain Number 3 Region: 564-758
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.86e-28
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D1M914_9PICO
Sequence length 893
Comment AC=D1M914; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Human parechovirus 4. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKGIADMATGITKTIDSTVNTVNETITNPSNAAGGDMLTKVADDASNVLGPNCFATT
STPENKDVVQATTTVNTTNLTQHPSAPTMPFTPDFRNVDMFHSMAYDVTTGDKNPSKLIR
LKTEFWERTYARQHLIVDVELPHAFWDNSNKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPAVTHSDKMEFGAFTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDL
GRLRVYVWAPLTIPSGATSTVDVTVLGSLLQLDFQNPRVYNTQVDIYDNNNETKTRQIRK
KKWLTMSTKYKWTRNKIDIAEGPGAMNMANVLSTTGAQSVALVGERAFYDPRTAGSKSRF
DDLVKIAQLFSVMSDSTTPSASSGIDDKGYFEWKATATPQTVIHRNVIKLNQFPNLNMFV
NSYSYFRGSLIIRLSVYASTFNRGRLRMGFFPNFTTNTTSEIDNSIYTICDIGSDNSFEI
TIPYTFSTWMRKTNGHALGLFQIEVLNRLTYNSSSPSSVHCIVQGRLGNDAKFFCPAGSL
VTFQNSWGSQMDLTDPLCVEDDCTEDCKQTISPDELGLTSAQDDGPLGGEKPNYFLNFRA
VNVDIFTVSHTKVDNIFGRAWFAYDHTYRDEGTWRQALDFPKKGHGALTQLFAYYSGELN
IHVLFLSETGFLRVAHTYDSDTNRSEFFSSNGVITVPAGEQMTLSVPFYSSKPLRTIRDS
AALGYVMCKPFMSGTTGGKIEIYLSLRCPNLFFPLPAPKPTSGRSLRGDMAQLTNESPYG
QPEIRKMKLAYLNRGFYKHYGIIVDDYVYQLDSDDIFKTALTGKAKFTKTKLTPDWIVEE
ECELDYFRVKYLESSVNSEHIFSVDSNCETIAKDIFGSHTLSQHQAIGLIGTT
Download sequence
Identical sequences D1M914
D1M914_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]