SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2IE11_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2IE11_9PICO
Domain Number 1 Region: 1715-2175
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.66e-112
Family RNA-dependent RNA-polymerase 0.0000186
Further Details:      
 
Domain Number 2 Region: 34-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.79e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0043
Further Details:      
 
Domain Number 3 Region: 282-539
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.16e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0048
Further Details:      
 
Domain Number 4 Region: 1514-1700
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.19e-28
Family Viral cysteine protease of trypsin fold 0.021
Further Details:      
 
Domain Number 5 Region: 556-756
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.18e-27
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.046
Further Details:      
 
Domain Number 6 Region: 1164-1305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000044
Family Nucleotide and nucleoside kinases 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2IE11_9PICO
Sequence length 2179
Comment AC=D2IE11; DE=SubName: Full=Polyprotein; OS=Human parechovirus 1. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKSIADMATGVVSSVDSTINAVNEKVENVGNEIGGNLLTKVADDASNVLGPNCYATT
AEPENKDVVQATTTVNTTNLTQHPSAPTMPFTPDFSNVDTFHSMAYDITTGEKNPSKLVR
LETHQWTPTWARGYQITHVELPKVFWDKNSKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVVTYDSKLEFGAFTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLKVYVWTPLSIPSGSATQVDVTILGSLLQLDFQNPRVFGQDVGIYDNAPTRKQNLKKI
LTMSTKYKWTRQKIDIAEGPGSMNMANVLSTTAAQSIALVGERAFYDPRTAGSKSRFDDL
VKISQLFSVMSDSTTPSANHGIDAKGYFKWSSTTAPQSVVHRNIVYLKLFPNLNVFVNSY
SYFRGSIVLRLSVYASTFNRGRLRMGFFPNATEDSTSEIDNAIYTICDLGSDNSFEITIP
YSFSTWMRKTDGHPIGLFQIEVLNRLTYNSSSPNEVYCIVQGKMGQDARFFCPTGSVVTF
QNSWGSQMDLTDPLCLEESAEECKQTISPNELGLTSAQDDGPLGDNKPNYFLNFKSMNVD
IFTVSHTKVDNLFGRAWFFKEHTFTDEGQWRVSLEFPKQGHGSLSLLFAYFTGELNIHVL
FLAEKGFLRVAHTYDTSENRVNFLSSNGVITIPAGEQMTLSAPYYSNKPLRTVRDSNSLG
YLMCKPFLTGTTRGKIEVYLSLRCPNFFFPLPAPKVTTGRALRGDMANFSNESLYDQQSQ
SQLMKLAYLDRGFYKHYGIIVGDSVYQLDSDDIFKTALTGKARFTKTKLTPDWVIEEECE
LDYFRVKYLESSVNSEHIFSVDHNCETIAKDIFGTHTLSQHHAIGLVGTILLTAGLMSTI
KTPVNATTIKEFFNHAVEGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILVRILC
YMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAESMSN
TDDDEIKEQICDTVKYTKTILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSVFKP
SIESKAIQWLERNKEHVCGILDYASDIIVESKDQSKVKTQDFYQRYSDCLAKFKPIMAMC
FRSCHNSISNTVYRLFQELARIPSRISTQNDLIRVEPIGIWIQGEPGQGKSFLTHTLSRQ
LQKSCKLNGIFTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISAVPFVVPMA
HLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKAGKLNVSQ
AMATMSTGECWEVSKNGRDWETLKLKDLVDKITVDYNERIKNYNAWKTQLENQTLDDLDD
AVSYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFANKVGAKISKASREV
IDWFSDKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEDSKDERAYNPTLPVA
KPKGTFPVSQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHGHSIK
YLEQEEELTLHYKNKVFPIESPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGT
ESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGN
FKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEITPIQPMYINTKSQIHKSPVYGAVE
VKMGPAVLSKSDTRLEEPVDCLIKKSASKYRVNKFQVNNELWQGVKACVKSKFREIFGIN
GIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVSPMLEKLVQEKFHN
LLKGNQITTIFNTCLKDELRKLDKIASGKTRCIEACEVDYCIVYRMIMMEIYDKIYQTPC
YYSGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDSPDLV
MQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDCLPI
VYGDDVILSLDKEIEPEKLQSIMADSFGAEVTGSRKDEPPSLKPRMEVEFLKRKPGYFPE
STFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYQHYIKILDPYLKEWN
ITVDDYEVVIAKLMPMVFD
Download sequence
Identical sequences D2IE11
D2IE11_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]