SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2IE19_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2IE19_9PICO
Domain Number 1 Region: 1714-2173
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.92e-111
Family RNA-dependent RNA-polymerase 0.0000195
Further Details:      
 
Domain Number 2 Region: 23-280
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.6e-53
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0046
Further Details:      
 
Domain Number 3 Region: 261-538
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 7.68e-52
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0064
Further Details:      
 
Domain Number 4 Region: 559-758
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.61e-31
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.028
Further Details:      
 
Domain Number 5 Region: 1512-1698
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-28
Family Viral cysteine protease of trypsin fold 0.026
Further Details:      
 
Domain Number 6 Region: 1147-1303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000119
Family Nucleotide and nucleoside kinases 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D2IE19_9PICO
Sequence length 2177
Comment AC=D2IE19; DE=SubName: Full=Polyprotein; OS=Human parechovirus 3. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
MESIKDLVNVATGAMDTLSLSNVETEANNIISGNEVGGEIITKVADDASNLLGPNSFATT
AQPENKDVVQATTTVNTTNLTQHPSAPTIPFTPDFRNVDNFHSMAYDITTGDKNPSKLIR
LDTASWQTSYSRQYKITTVELPKSFWDDTRKPAYGQAKYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVIDSRQYLEFGSLTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLRVYVWTPLSVPTGASNEVDVTVMGSLLQLDFQNPRPYGEDVEIYDNGPNKANASRFN
KRKFLTASTKYKWTRNKVDIAEGPGTMNMANVLSTTGAQSVALVGERAFYDPRTAGSKSR
FDDMIKIAQLFSVMSDNTTPSSSSGIDKYGYFDWAATVAPQNMVHRNVVTLDQFPNLNLF
MNTYSYFRGSLIIRLSIYASTFNRGRLRMGFFPNCTHDTQLELDNAIYTICDIGSDNSFE
LTIPYSFSTWMRKTHGHQLGLFQVEVLNRLTYNSSSPNKVHCIVQGRLGDDAKFFCPTGS
LVSFQNSWGSQMDLTDPLCIEDNMENCKQSISPNELGLTSAQDDGPLGNEKPNYFLNFRT
MNVDIFTVSHTKVDNIFGRAWYVTSHDFNNGDTWRQKLTFPKEGHGMLSQFFAYFTGEIN
IHILYMAEQGFLRVAHTYDTEDNRKTFLSSNGVITIPAGEQMTLSVPFYSNKPLRTVRHD
SALGFLMCRPMMHGTTRTTAEVYISLRCPNFFFPVPAPKPTGSGAVALYDESPYVPTDNR
KMQLAYLDRGFYKHYGIIVGDSVYQLDSDDIFKTALTGKARFTRTKLTPDWVIEEECELD
YFRVKYLESSVNSEHIFSVDHNCETIAKDIFGTHTLNQHQAIGLVGTILLTAGLMSTIKT
PVNATTIKEFFNHAVEGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILVRILCYM
VLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAESMSNTD
DEEIKEQICDTVKYTKSILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSVFKPSM
ESKAIQWLERNKEHVCAILDYASDIIVESKDQTKMKSQEFYQKYTDCLSKFKPIMAICFR
SCHNSISNTVYRLFQELARIPSRISTQNDLIRVEPIGIWIQGEPGQGKSFLTHTLSRQLQ
KSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFIVPMAHL
EEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKAGKLNVSQAM
STMATGECWEVSKNGRDWETLKLKELVQKITEDYQERQKNYNCWKQQLENQTLDDLDDAV
SYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFATRVANQTRKAAKEVVE
WFSSKIKLMLSFVERNKAWLTVASAVTSAISILLLVTKIFKKEDSKDERAYNPTLPVAKP
KGTFPVSQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHGHSIKYL
EQEEDLTLHYKNKVFPIENPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTES
MLIWMTEQGIITKEVKRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFK
ILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEITPLQPMYINTRTQIHKSPVYGAVEVK
MGPAVLSKSDPRLEEPVECLIKKSAAKYRVNKFQVNNELWQGVKACVKSKFREIFGINGI
VDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVSPMLEKLVQDKFHALL
KGNQITTIFNTCLKDELRKLDKISAGKTRCIEACEVDYCIVYRMIMMEIYDKIYQTPCYY
SGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDSPDLVIQ
LHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDCLPIVY
GDDVILSLDREIDPEKLQGIMADSFGAEVTGSRKDEPPSLKPRLEVEFLKRKPGYFPEST
FIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYLYYIKILDPYLKEWNIT
VDDYDVVIAKLMPMVFD
Download sequence
Identical sequences D2IE19
D2IE19_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]