SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D2IE20_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D2IE20_9PICO
Domain Number 1 Region: 1713-2173
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 8.4e-112
Family RNA-dependent RNA-polymerase 0.0000192
Further Details:      
 
Domain Number 2 Region: 23-280
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 9.85e-54
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0046
Further Details:      
 
Domain Number 3 Region: 261-538
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.26e-51
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0064
Further Details:      
 
Domain Number 4 Region: 559-758
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.87e-30
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.034
Further Details:      
 
Domain Number 5 Region: 1512-1698
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7e-28
Family Viral cysteine protease of trypsin fold 0.027
Further Details:      
 
Domain Number 6 Region: 1147-1315
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000146
Family RecA protein-like (ATPase-domain) 0.079
Further Details:      
 
Weak hits

Sequence:  D2IE20_9PICO
Domain Number - Region: 923-1040,1096-1147
Classification Level Classification E-value
Superfamily ARM repeat 0.0446
Family Regulatory subunit H of the V-type ATPase 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D2IE20_9PICO
Sequence length 2177
Comment AC=D2IE20; DE=SubName: Full=Polyprotein; OS=Human parechovirus 3. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
MESIKDLVNVATGAMDTLSLSNVETEANNIISGNEVGGEIITKVADDASNLLGPNSFATT
AQPENKDVVQATTTVNTTNLTQHPSAPTIPFTPDFRNVDNFHSMAYDITTGDKNPSKLIR
LDTAQWQTSYSRQHQITTVELPKSFWNDTRKPAYGQAKYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVIDSRQYLEFGSLTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLRVYVWTPLSVPTGASNEVDVTVMGSLLQLDFQNPRPYGENVEIYDNGPNKVNASKFN
KRKFLTASTKYKWTRTKVDIAEGPGTMNMANVLSTTGAQSVALVGERAFYDPRTAGSKSR
FDDMIKIAQLFSVMSDNTTPSSSSGIDKYGYFDWAATVAPQNMVHRNVVTLDQFPNLNLF
MNTYSYFRGSLILRLSIYASTFNRGRLRMGFFPNCTHDTQLELDNAIYTICDIGSDNSFE
LTIPYSFSTWMRKTHGHQLGLFQVEVLNRLTYNSSSPNKVHCIVQGRLGDDAKFFCPTGS
LVSFQNSWGSQMDLTDPLCIEDNMENCKQSISPNELGLTSAQDDGPLGNEKPNYFLNFRT
MNVDIFTVSHTKVDNIFGRAWYVTSHDFNNGDTWRQKLTFPKEGHGMLSQFFAYFTGEIN
IHILYMAEQGFLRVAHTYDTEENRKTFLSSNGVITIPAGEQMTLSVPFYSNKPLRTVRHE
SALGFLMCRPMMHGTTRTTAEVYISLRCPNFFFPVPAPKPTGTRAIAFHDESPYVSPEKK
NMKLAYLDRGFYKHYGIIVDDYVYQLDSDDIFKTALTGKAKFTKTKLTQDWIVEEECELD
YFRVKYLESSVNSEHIFSVDSNCETIAKDIFGTHTLSQHQAIGLIGTILLTAGLMSTIKT
PVNAKTIKEFFNHAIDGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILVRILCYM
VLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAESMSNTD
DEEIKEQICDTVKYTKSILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSVFKPSM
ESKAIQWLERNKEHVCAILDYASDIIVESKDQTKMKSQEFYQKYTDCLAKFKPIMAICFR
SCHNSISNTVYRLFQELARIPSRISTQNDLIRVEPIGVWIQGEPGQGKSFLTHTLSRQLQ
KSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFIVPMAHL
EEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKSGKLNVSQAM
STMATGECWEVSKNGRDWETLKLQDLVKKITEDYEERQKNYNCWKQQLENQTLDDLDDAV
SYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFATKVANQTRKAAKEVVD
WFSSKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEDSKDERAYNPTLPVAKS
KGTFPVTQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHGHSIKYL
EQEEELTLHYKNKVFPVENPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIGTES
MLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEGNFK
ILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEVTPIQPMYINTRTQIHKSPVYGAVEVK
MGPAVLSKSDPRLEEPVECLIKKSASKYRVNKFQVNNELWQGVKACVKSKFREIFGVNGI
VDMKTAILGTTHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVSPMLEKLVQDKFHNLL
KGNQITTIFNTCLKDELRKLDKISAGKTRCIEACEVDYCIVYRMIMMEIYDKIYQTPCYY
SGLAVGINPYKDWHFMISALNEYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDTPELVMQ
LHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDCLPIVY
GDDVILSLDKEIDPEKLQSIMAESFGAEVTGSRKDEPPSLKPRLEVEFLKRKPGYFPEST
FIVGKLDTENMIQHLMWMKNFGTFKQQLQSYLMELCLHGKDTYLHYIKILDPYLKEWNII
VDDYDVVIAKLMPMVFD
Download sequence
Identical sequences D2IE20
D2IE20_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]