SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D7F4K2_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D7F4K2_9PICO
Domain Number 1 Region: 1719-2178
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.93e-113
Family RNA-dependent RNA-polymerase 0.0000197
Further Details:      
 
Domain Number 2 Region: 18-283
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.19e-52
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0019
Further Details:      
 
Domain Number 3 Region: 281-537
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.56e-45
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0067
Further Details:      
 
Domain Number 4 Region: 556-755
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.17e-28
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.051
Further Details:      
 
Domain Number 5 Region: 1517-1703
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.18e-28
Family Viral cysteine protease of trypsin fold 0.02
Further Details:      
 
Domain Number 6 Region: 1153-1308
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000473
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D7F4K2_9PICO
Sequence length 2182
Comment AC=D7F4K2; DE=SubName: Full=Polyprotein; OS=Human parechovirus 6. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKSIADMATGITGTVDSTINSVNETIGNTDNASGGDILTRVADDASNVLGPNCYATT
SEPENKDVVQATTTVNTTNLTQHPSAPTMPFTPDFANVDNFHSMAYDITSGDKNPSKLIR
LETGDWTLTAKRSDKIMHVELPKAFWNEQRKPAYGQAKYFAAVRCGFHFQVQINVNQGAA
GSALVVYMPKPVVDHETKMEFGAFTNLPHVLMNLAETTQADLCIPYVSDTNYVMTDSSDL
GHLRVYVWTPLSMPTGITTQVDVTVLGSQLQLDFQNPRPYNKQVNIYDNGPTKMISKKKI
LTMSTKYKWTRNKFDIAEGPGSMNMANVLSTTGAQSVALVGERAFYDPRSAGSRSRFDDL
VKITQLFSVMADSDTPSTTHGHDAKGYFKWSATTNPMYIVHRNIVYLRLFPNINNFVNSF
SYFRGSLVLRLNVYASTFNRGRLRMGFFPNASEDTDEELDNAIYTICDIGSDNSFEITIP
YSFSTWMRKTAGHPIGLLQIEVLNRLTYNSSSPSEVFCILQGRMGEDAKFFCSTGSIVTF
QNSWGSQMDLSDPLCIEDDAENCKQTISPNELGLTSAQDDGPLGGEKPNYFLNFRTMNVD
IFTVSHTKVDNIFGRAWFVISHDFNNEGQWPLDLTFPFEGHGSLSLLFAYFTGELNIHVL
FLSDKGFLRVVHTYDTADNRLVNLASNGVITIPAGEQMSLSAPFYSHKPLRTVRDTHSLG
RLICKPFLTGTTSGRIEVYMSLRCPNFFFPVPAPKNTPRTQSRALRGDMANLANRSPYDQ
QPRSQMMKLAYLDRGFYKHYGIIVGEYVYQLDSDDIFKTALTGRAKFTKTRLTSEWIVEE
ECELDYFRIKYLESAVNSEHIFSVDKNCETIAKDIFGTHTLSQHQAIGLIGTILLTAGLM
STIKTPVNATTIKEFFNHAIEGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIIKILVR
ILCYMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAES
MSNTDDDEIKEQICDTVKYTKTILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSV
FKPSLESKAIQWLERNKEHVCGILDYASDIIVESKDQSKVKTQDFYQRYSDCLSKFKPIM
AICFRSCHNSISNTVYRLFQELARIPNRISTNNDLIRIEPIGIWIQGEPGQGKSFLTHTL
SRQLQKSCKLNGVFTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFIV
PMAHLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKAGKLN
VSQAMAAMSTGECWEVSKNGRDWETLKLKELVDKITIDYTERVKNYNAWKQQLENQTLDD
LDDAVSYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPKPSVFKCFANKIGTKISKAS
KEVVDWFSCKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEESKDERAYNPTL
PVTKPKGTFPVTQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHGH
SIKYLEQEEELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNK
IGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKV
EGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIITDVTPIQPMYINTKTQIHKSPVYG
AVEVKMGPAVLSKSDPRLEEPVECLIKKSAAKYRVNKFQVNNELWQGVKACVKSKFREIF
GVNGIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVSPMLEKLVQDK
FHNLLKGNQITTIFNTCLKDELRKLDKITSGKTRCIEACEVDYCIVYRMIMMEIYDKIYQ
TPCYYSGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDSP
DLVMQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDC
LPIVYGDDVILSLDKEIEPEKLQSTMAESFGAEVTGSRKDEPPSLKPRMEVEFLKRKPGY
FPESTFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDIYQHYIKILDPYLR
EWNITVDDYDVVIAELMPMVFD
Download sequence
Identical sequences D7F4K2
D7F4K2_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]