SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for O39818_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  O39818_9PICO
Domain Number 1 Region: 1785-2236
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.48e-108
Family RNA-dependent RNA-polymerase 0.00000000186
Further Details:      
 
Domain Number 2 Region: 10-202
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.74e-80
Family FMDV leader protease 0.00016
Further Details:      
 
Domain Number 3 Region: 208-512
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 6.62e-75
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000609
Further Details:      
 
Domain Number 4 Region: 550-744,778-967
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.01e-49
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000218
Further Details:      
 
Domain Number 5 Region: 1584-1777
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.17e-44
Family Viral cysteine protease of trypsin fold 0.0000265
Further Details:      
 
Domain Number 6 Region: 1196-1378
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000167
Family ABC transporter ATPase domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) O39818_9PICO
Sequence length 2247
Comment AC=O39818; DE=SubName: Full=Polyprotein; OS=Equine rhinitis A virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MAASKVYRVCEQTLLAGAVRMMDKFLQKRTVFVPHLDKTIRLTGLHNYDNTCWLNALTQL
TQILGIRLFDEHFGNRGLFTRKTIDWVSDQTGIKDLKSGAPPLVVVYKLWQHGHLDVGTM
EKPRSITLWSGPKVCLSDFWACVSAKPGHAVFYLLTSEGWICVDDKKIYPETPKTEDVLV
FAPYDFESLGKDPPKLHQRYEKAFELSGGGTSTPTTGNQNMSGNSGSIVQNFYMQQYQNS
IDADLGDNVISPEGQGSNTSSSTSSSQSSGLGGWFSSLLNLGTKLLADKKTEETTNIEDR
IETTVVGVTIINSQGSVGTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQ
SHGHAWICPLPGDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNPSFAHSGPLCVAAVPEYE
HTHEKALKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGQPTNLTLHNPWT
IVILILSELTGPGQTVPVTMSVAPIDAMVNGPLPNPEAPIRVVSVPESDSFMSSVPDNST
PLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAA
ELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMACIH
AVWDVGLNSAFSFNVPYPSPADFMAVYSAERTVVNVSGWLQVYALTALTSTDIAVNSKGR
VLVAVSAGPDFSLRHPADLPDKQVTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRF
FDVETLELSNLTGSPATHVLDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSV
GEGFVWVKWLPVGAPTKTTDAWQLEGGGNSVRIQKLAVAGMCPTVVFKIAGSRSQACASA
LPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYAFRAPA
MYCPRPIPPAFTRPADKTRHKFPTNINKQCTNYSLLKLAGDVESNPGPTIFSKASADLNA
LSTSLGELTGMLKDLKAKAETYSPFYKMAKMLFKLATLAVAAMRTKDPVVVVMLIADFGL
EVFDTGFFFSYFQEKLQPYMKTIPGKISDLVTDAATAAAQIPKGVYSFVSSFFETPEGVV
EKQVSLRTVNDIFALLKNSDWFIKTLVALKKWLTSWFAQEQQADDALYSELEKYPLYKLK
LKEPDTQEEARQWFKDMQQRALAVKDKGLFSLLQIPLVNLPQSRPEPVVCVLRGASGQGK
SYLANLMAQAISLLLVGKQDSVWSCPPDPTYFDGYNGQAVVIMDALGQDPNGADFKYFCQ
MVSTTAFVPPMAHLDDKGIPFTSPVVICTTNLHSSFTPITVSCPEALKRRFRFDVTVSAK
PGFVRTVGSNQLLNLPLALKPAGLPPHPIFENDMPIINGQAVKLALSGGEVTAFELIEMI
LSEVQNRQDTHKMPIFKQSWSDLFRKCTTDEEQKMLQFLIDNKDSEILRAFVSERSILLH
EEYLKWESYMTRRAKFHRLAADFAMFLSILTSLIVIFCLVYSMYQLFKTPDEGSAYDPST
KPKPKTQEVKTLKIRTETGVPATDLQQSIMKNVQPIELYLDNELVTDCSALGVYDNSYLV
PLHLFEFDFDTIVLGGRHYKKAECEKVEFELEVNGDVVSSDACLLRVSSGPKVRNIVHLF
TNEIELKKMTQVTGIMNSPHQARTVFFGSFLTVRKSILTSDGTVMPNVLSYAAQTSRGYC
GAAIVAGSPARIIGIHSAGTGSVAFCSLVSRDALEQLWPQKQGNVSRLDDDVRVSVPRRS
KLVKSLAYPIFKPDYGPAPLSQFDKRLSDGVKLDEVVFAKHTGDKEISAQDQKWLLRAAH
VYAQKVFSRIGFDNQALTEKEAICGIPGLDKMEQDTAPGLPYAQQNKRRKDICDFEEGRL
KGAELQKDRFMAGDYSNLVYQSFLKDEIRPLEKVRAGKTRLIDVPPMPHVVVGRQLLGRF
VAKFHEANGFDIGSAIGCDPDVDWTRFGLELERFRYVYACDYSRFDANHAADAMRVVLNY
FFSEDHGFDPGVPAFIESLVDSVHAYEEKRYNIYGGLPSGCSCTSILNTILNNVYILAAM
MKAYENFEPDDIQVICYGDDCLIASDFEIDFQQLVPVFSSFGQVITTADKTDFFKLTTLS
EVTFLKRAFVLTAFYKPVMDVKTLEAILSFVRPGTQAEKLLSVAQLAGHCEPEQYERLFE
PFAGMYFVPTWRLAPAVVDEAWMLNSF
Download sequence
Identical sequences O39818
O39818_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]