SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POLG_AEVVR from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POLG_AEVVR
Domain Number 1 Region: 1656-2123
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.44e-106
Family RNA-dependent RNA-polymerase 0.00000125
Further Details:      
 
Domain Number 2 Region: 5-241
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 6.44e-47
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0011
Further Details:      
 
Domain Number 3 Region: 251-493
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.34e-45
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.001
Further Details:      
 
Domain Number 4 Region: 1436-1643
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.75e-37
Family Viral cysteine protease of trypsin fold 0.0000265
Further Details:      
 
Domain Number 5 Region: 485-731
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 6.3e-34
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.01
Further Details:      
 
Domain Number 6 Region: 1141-1280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000121
Family Extended AAA-ATPase domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) POLG_AEVVR
Sequence length 2134
Comment AC=Q6R325; DE=RecName: Full=Genome polyprotein; Contains: RecName: Full=Protein VP0; AltName: Full=VP4-VP2; Contains: RecName: Full=Protein VP4; AltName: Full=P1A; AltName: Full=Virion protein 4; Contains: RecName: Full=Protein VP2; AltName: Full=P1B; AltName: Full=Virion protein 2; Contains: RecName: Full=Protein VP3; AltName: Full=P1C; AltName: Full=Virion protein 3; Contains: RecName: Full=Protein VP1; AltName: Full=P1D; AltName: Full=Virion protein 1; Contains: RecName: Full=Protein 2A; Contains: RecName: Full=Protein 2B; Contains: RecName: Full=Protein 2C; Contains: RecName: Full=Protein 3A; Contains: RecName: Full=Protein 3B; AltName: Full=VPg; Contains: RecName: Full=Picornain 3C; AltName: Full=Protease 3C; Contains: RecName: Full=RNA-directed RNA polymerase 3D-POL; OS=Avian encephalomyelitis virus (strain Van Reokel) (AEV). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Tremovirus.
Sequence
MSKLFSTVGRTVDEVLSVLNDEDTESYAGPDRTAVVGGGFLTTVDQSSVSTATMGSLQDV
QYRTAVDIPGSRVTQGERFFLIDQREWNSTQSEWQLLGKIDIVKELLDQSYAVDGLLKYH
SYARFGLDVIVQINPTSFQAGGLIAALVPYDQVDIESIAAMTTYCHGKLNCNINNVVRMK
VPYIYSRGCYNLRNSAYSIWMLVIRVWSRLQLGSGTSTQITITTLARFVDLELHGLSPLV
AQMMRNEFRLSSSSNIVNLANYEDARAKVSLALGQEGFSRDSSSTGGGMLYHFSQWTSIP
CLAFIFTFPGTVGPGTRIWSTTVDPFSCNLRAFSTVHPTNLSSIAGMFCFWRGDIVFEFQ
VFRTKYHSGRLMFVYVPGDENTKISTLTATQASSGLTAVFDINGVNSTLVFRCPFISDTP
YRVNPTTHKSPWPYATGKLVCYVYNRLNAPASVSPSVSINVYKSAVDLELYAPVYGVSPT
NTSVFAQGKGDEGGFSSVPEVEQHVVEDKEPQGPLHVTPFGAVKAMEDPQLARKTPGTFP
ELAPGKPRHTVDHMDLYKFMGRAHYLWGHKFTKTDMQYTFQIPLSPIKEGFVTGTLRWFL
SLFQLYRGSLDITMTFAGKTNVDGIVYFVPEGVAIETERKEQTPLLTLNYKTSVGAIRFN
TGQTTNVQFRIPFYTPLEHIATHSKNAMDSVLGAITTQITNYSAQDEYLQVTYYISFNED
SQFSVPRAVPVVSSFTDTSSKTVMNTYWLDDDELVEESSHFSFDEIEEAQCSKCKIDLGD
IVSCSGEKAKHFGVYVGDGVVHVDPEGNATSWFMKRKATVKKSKNLDKWCFALSPRIDRT
LICETANLMVGREVEYDIFVKNCETYARGIASGDYGTKEGEKWKTLLSAVGVAAMTTTMM
AMRHELLDTSLTKLPQKVGEVTDEVRKILEDTSAGVREFKEKVSSILRKTWPGKTSIKIM
KWTCRIVKMCVGVGLCYMHGWDSKTVTAVVTMFSMDFLDLVIDGIEIGRMIIDELTTPKA
QGLSEINQVLSIAKNAKDVIKMLIEIFCKVIERITGEHGKKIQWAQDKKEEIMNVLERAE
KWITTSDDHSEGIECLKLVRSIQSVIRGEESLKELAGELRAVGTHVLNKLGRLDKPNAPI
LVRAEPTVLYLYGNRGGGKSLASMAIAVKLCKELGISHVEGIYTKPIMSDFWDGYAGQPV
VIMDDLGQSTSDEDWTNFCQLVSSCPLRLNMANLEKKGTQFNSPFIIASSNLSHPCPKTV
YCTDAIARRLHIKVKVSPKEEFSTHAMLDVAKAKKVGAYCNLDCLDLQKISDLASTPVSV
QDIVLEMLHTNVDKQTLMGDIIQYWAQSNPREVFDTMAEGKNSGKYLWLFERLKTSKWYI
LGCVGAVLAVSALGVFAYHMIKNHFRDQQHDQSAYSVAIKPLRVVRLEQSDAQSVVDISN
VVHGNLVRVGVGPNEARIHWLYNGLGVYDTYILMPYHGIKDADVDDDLYIERAGTIYSTN
MKMVQVLFLESREGDLVLINVPRLPKFRDIRNHFSTEENIRRAEGMPGTLCTLDHERFTL
VTESDLKMVEAATYVCEDDKGVRTDISVGRSWKAKACTVAGMCGGALVTSNNKMQNAIVG
IHVAGGAHAISRVITKEMIEEMLKTRAQCSRIWKTEFVEEKISVGSKTKYHKSPLYDFCP
QEVVKCPTKLFYQGEIDVMQVMLAKYSSPIVSEPSGYATVVEAYTNRMVSFFPEPRQLTY
DECINGIEGLDAIDLKTSAGFPYNTLGLRKSDLIINGKMAHRLQQDVEKMEEDLHMNRSI
QVVFTTCAKDELRPLSKVMLGKTRAIEACPVSFTILFRRYLGYALAQIQSHPGFHTGIAV
GVDPDQDWHCMWYSIVTQCDLVVGLDFSNYDASLSPFMIYHAGRVLGQICGLDPRLVDRI
MEPIVNSVHQLGSMRYYVHGSMPSGTPATSVLNSIINVVNICYVLCALEEISVFEVFKLF
KILTYGDDVLLCIKKEYLDQKSFPLSSFVQGLEELGLSPTGADKMEVKVTPVHKMSFLKR
TFYVDEWSICHPRISEETVYSMLAWKSDNASMKDLIETSIWFMFHHGPRKYVRFCTWLRG
VLCRVGIGLYIPTYKELEVRYDRLVKYRFIDDNF
Download sequence
Identical sequences Q6R325
POLG_AEVVR

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]