SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POLG_EC22H from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POLG_EC22H
Domain Number 1 Region: 1716-2175
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.88e-112
Family RNA-dependent RNA-polymerase 0.0000192
Further Details:      
 
Domain Number 2 Region: 280-540
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.21e-51
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0043
Further Details:      
 
Domain Number 3 Region: 32-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.16e-48
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0046
Further Details:      
 
Domain Number 4 Region: 557-757
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.61e-30
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.044
Further Details:      
 
Domain Number 5 Region: 1515-1701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.5e-28
Family Viral cysteine protease of trypsin fold 0.021
Further Details:      
 
Domain Number 6 Region: 1149-1306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000152
Family RecA protein-like (ATPase-domain) 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POLG_EC22H
Sequence length 2180
Comment AC=Q66578; Q90062; DE=RecName: Full=Genome polyprotein; Contains: RecName: Full=Protein VP0; AltName: Full=P1AB; AltName: Full=Virion protein 0; Contains: RecName: Full=Protein VP3; AltName: Full=P1C; AltName: Full=Virion protein 3; Contains: RecName: Full=Protein VP1; AltName: Full=P1D; AltName: Full=Virion protein 1; Contains: RecName: Full=Picornain 2A; Contains: RecName: Full=Protein 2B; Contains: RecName: Full=Protein 2C; Contains: RecName: Full=Protein 3A; Contains: RecName: Full=Protein 3B; AltName: Full=VPg; Contains: RecName: Full=Picornain 3C; AltName: Full=Protease 3C; Contains: RecName: Full=RNA-directed RNA polymerase 3D-POL; OS=Echovirus 22 (strain Harris) (Human parechovirus 1). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKSIADMATGVVSSVDSTINAVNEKVESVGNEIGGNLLTKVADDASNILGPNCFATT
AEPENKNVVQATTTVNTTNLTQHPSAPTMPFSPDFSNVDNFHSMAYDITTGDKNPSKLVR
LETHEWTPSWARGYQITHVELPKVFWDHQDKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPVVTYDSKLEFGAFTNLPHVLMNLAETTQADLCIPYVADTNYVKTDSSDL
GQLKVYVWTPLSIPTGSANQVDVTILGSLLQLDFQNPRVFAQDVNIYDNAPNGKKKNWKK
IMTMSTKYKWTRTKIDIAEGPGSMNMANVLCTTGAQSVALVGERAFYDPRTAGSKSRFDD
LVKIAQLFSVMADSTTPSENHGVDAKGYFKWSATTAPQSIVHRNIVYLRLFPNLNVFVNS
YSYFRGSLVLRLSVYASTFNRGRLRMGFFPNATTDSTSTLDNAIYTICDIGSDNSFEITI
PYSFSTWMRKTNGHPIGLFQIEVLNRLTYNSSSPSEVYCIVQGKMGQDARFFCPTGSVVT
FQNSWGSQMDLTDPLCIEDDTENCKQTMSPNELGLTSAQDDGPLGQEKPNYFLNFRSMNV
DIFTVSHTKVDNLFGRAWFFMEHTFTNEGQWRVPLEFPKQGHGSLSLLFAYFTGELNIHV
LFLSERGFLRVAHTYDTSNDRVNFLSSNGVITVPAGEQMTLSAPYYSNKPLRTVRDNNSL
GYLMCKPFLTGTSTGKIEVYLSLRCPNFFFPLPAPKVTSSRALRGDMANLTNQSPYGQQP
QNRMMKLAYLDRGFYKHYGIIVGDHVYQLDSDDIFKTALTGKAKFTKTKLTSDWVIEEEC
ELDYFRIKYLESAVDSEHIFSVDKNCETIAKDIFGTHTLSQHQAIGLVGTILLTAGLMST
IKTPVNAVTIKEFFNHAIDGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILVRIL
CYMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEIVAESMS
NTDDDEVKEQICDTVKYTKTILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLSVFK
PSIESKAIQWLERNKEHVCSILDYASDIIVESKDQSKMKTQDFYQRYSDCLAKFKPIMAI
CFRSCHNSISNTVYRLFQELARIPNRISTNNDLIRIEPIGIWIQGEPGQGKSFLTHTLSR
QLQKSCKLNGVFTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFIVPM
AHLEEKGKFYTSKLVVATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKAGKLNVS
QAMATMSTGECWEVSKNGRDWETLKLKDLVDKITIDYNERVKNYNAWKQQLENQTLDDLD
DAVSYIKHNFPDAIPYVDEYLNIEMSTLIEQMEAFIEPKPSVFKCFANKIGSKISKASRE
VVDWFSDKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEESKDERAYNPTLPV
AKPKGTFPVSQREFKNEAPYDGQLEHIISQMAYITGSTTGHMTHCAGYQHDEIILHGHSI
KYLEQEDELTLHYKNKVFPIEQPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTNKIG
TESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISKVEG
NFKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEITPIQPMYINTKTQIHKSPVYGAV
EVKMGPAVLSKSDTRLEEPVECLIKKSASKYRVNKFQVNNELWQGVKACVKSKFREIFGM
NGIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVAPLLERLVQDKFH
NLLKGNQITTTFNTCLKDELRKLDKIASGKTRCIEACEVDYCIVYRMIMMEIYDKIYQTP
CYYSGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDSPDL
VMQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGIDCLP
IVYGDDVILSLDKEIEPEKLQSIMADSFGAEVTGSRKDEPPSLKPRMEVEFLKRKPGYFP
ESTFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYQHYIKILEPYLQEW
NITVDDYDVVITKLMPMVFD
Download sequence
Identical sequences Q66578
POLG_EC22H

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]