SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POLG_EC23C from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POLG_EC23C
Domain Number 1 Region: 1724-2184
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 6.92e-112
Family RNA-dependent RNA-polymerase 0.0000216
Further Details:      
 
Domain Number 2 Region: 30-279
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.24e-53
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0059
Further Details:      
 
Domain Number 3 Region: 283-545
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 8.07e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0036
Further Details:      
 
Domain Number 4 Region: 1523-1709
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.75e-28
Family Viral cysteine protease of trypsin fold 0.026
Further Details:      
 
Domain Number 5 Region: 565-764
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 9.81e-27
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.037
Further Details:      
 
Domain Number 6 Region: 1158-1314
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000166
Family Nucleotide and nucleoside kinases 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) POLG_EC23C
Sequence length 2188
Comment AC=Q9YID8; DE=RecName: Full=Genome polyprotein; Contains: RecName: Full=Protein VP0; AltName: Full=P1AB; AltName: Full=Virion protein 0; Contains: RecName: Full=Protein VP3; AltName: Full=P1C; AltName: Full=Virion protein 3; Contains: RecName: Full=Protein VP1; AltName: Full=P1D; AltName: Full=Virion protein 1; Contains: RecName: Full=Picornain 2A; Contains: RecName: Full=Protein 2B; Contains: RecName: Full=Protein 2C; Contains: RecName: Full=Protein 3A; Contains: RecName: Full=Protein 3B; AltName: Full=VPg; Contains: RecName: Full=Picornain 3C; AltName: Full=Protease 3C; Contains: RecName: Full=RNA-directed RNA polymerase 3D-POL; OS=Echovirus 23 (strain CT86-6760) (Human parechovirus 2). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKSIADMATGFTNTIDSTVNAVTEGVSKIGNDSGGEILTKVADDASNLLGPNCVAST
SQPENKDVVQATTTVNTLTNLTQHPSAPTMPFTPDFSNVDVFHSMAYDITTGDKNPSKLI
RLDTTTWQHTWPRQHLINDVELPKAFWDKNSKPAYGQSRYFAAVRCGFHFQVQINVNQGT
AGCALVVYEPKPIVTHGGHLEFGSYTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSD
LGRLRVYVWTPLTIPSSATNDVDVTVLGSLLQLDFQNPRTYDTDVNIYDNSPLDTKTKYG
KLRFSKKILSMSTKYKWTRNKIDIAEGPGSMNMANVLSTTGAQSIALVGERAFYDPRTAG
SKSRFGDMIHIAQLFSVMSDTTTPSTSSGIDDLGYLDWSATYVPQQVIHRNVVKLNQFSN
LKPFVNAYTYFRGSLVLRMSVYASTFNRGRLRMGFFPNFTTNTTSEMDNAIYTICDIGSD
NSFEITIPYTFSTWMRKTNGRPIGLFQVEVLNRLTYNSSCPNKVHCIVQGRLGNDARFYC
PTGSLVEFQNSWGSQMDLTDPLCVEDDEAEDCKQTISPDELGLTSAQDDGPLGVEKPNYF
LNFRAINVDIFTVSHTKVDNIFGRAWLALEHTFADDGTWRADLNFPTQGHGTLTRLFTYY
SGELNVHVLYLSDNGFLRVTHAYDHDNDRSNFLSSNGVITVPAGEQMTLSVPFYSSKPLR
TIRETGALGKLICKPLLSGTHSGKIEVYLSLRCPNLFFPSPAPKEKTSRALRGDLANFID
QSPYGQQQQTQMMKLAYLDRGFYKHYGIIVGGYVYQLDSDDIFKTALTGKARFTKTRLTP
DWIVEEECELDYFRVKYLESSVNSEHIFSVDSNCETIAKDIFGTHTLSQHQAIGLVGAIL
LTAGLMSTIKTPVNATTIKEFFNHAIDGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFI
VKILVRILCYMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLA
EVVAESMSNTDDDEIKEQICDTVKYTKTILSNQGPFKGFNEVSTAFRHVDWWIHTLLKIK
DMVLSVFKPSIESKAIQWLERNKEHVCSILDYASDIIVESKDQTKMKTQEFYQRYSDCLA
KFKPIMAICFRSCHNSISNTVYRLFQELARIPNRISTQNDLIRVEPIGVWIQGEPGQGKS
FLTHTLSRQLQKSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCIS
SVPFIVPMAHLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYS
KSGKLNVSQAMSTMSTGECWEVSKNGRDWETLKLKDLVQKITEDYQERQKNYNAWKQQLE
NQTLDDLDDAVSYIKHNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFAVKLPH
KPGKQPRKLWAGSAGKIKSMLSFIERNKAWLTVVSAVTSAISILLLVTKIFKKEESKDER
AYNPTLPITKPKGTFPVSQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDE
IILHGHSIKYLEQEEDLTLHYKNKVFPIENPSVTQVTLGGKPMDLAILKCKLPFRFKKNS
KYYTNKIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGG
LLISKVEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIITEVTPIQPMYINTKSQIH
KSPVYGAVEVKMGPAVLSKSDTRLEEPVDCLIKKSASKYRVNKFQVNNELWQGVKACVKS
KFREIFGVNGIVDMKTAILGTSHVNSMDLSTSAGYSLVKSGYKKKDLICLEPFSVSPMLE
KLVQDKFHNLLKGNQITTIFNTCLKDELRKLDKIAAGKTRCIEACEVDYCIVYRMIMMEI
YDKIYQTPCYYSGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLA
YCHDSPDLVMQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLI
SPGVDCLPIVYGDDVILSLDREIEPERLQSIMADSFGAEVTGSRKDEPPSLKPRMEVEFL
KRKPGYFPESTFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDIYQRYIKI
LDPYLKEWNIVVDDYDVVIAKLMPMVFD
Download sequence
Identical sequences Q9YID8
POLG_EC23C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]