SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for POLG_TMEVD from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  POLG_TMEVD
Domain Number 1 Region: 1843-2300
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 4.04e-112
Family RNA-dependent RNA-polymerase 0.0000000149
Further Details:      
 
Domain Number 2 Region: 76-409
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.98e-103
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000000000487
Further Details:      
 
Domain Number 3 Region: 449-900
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.86e-83
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000019
Further Details:      
 
Domain Number 4 Region: 1639-1830
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.54e-42
Family Viral cysteine protease of trypsin fold 0.0063
Further Details:      
 
Weak hits

Sequence:  POLG_TMEVD
Domain Number - Region: 1298-1436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000181
Family RecA protein-like (ATPase-domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) POLG_TMEVD
Sequence length 2301
Comment AC=P13899; Q88564; Q88565; Q88566; Q88567; Q88568; Q88569; Q88570; AC=Q88571; Q88572; Q88573; Q88574; Q89580; DE=RecName: Full=Genome polyprotein; Contains: RecName: Full=Protein VP0; AltName: Full=VP4-VP2; Contains: RecName: Full=Protein VP4; AltName: Full=P1A; AltName: Full=Virion protein 4; Contains: RecName: Full=Protein VP2; AltName: Full=P1B; AltName: Full=Virion protein 2; Contains: RecName: Full=Protein VP3; AltName: Full=P1C; AltName: Full=Virion protein 3; Contains: RecName: Full=Protein VP1; AltName: Full=P1D; AltName: Full=Virion protein 1; Contains: RecName: Full=Protein 2A; Contains: RecName: Full=Protein 2B; Contains: RecName: Full=Protein 2C; Contains: RecName: Full=Protein 3A; Contains: RecName: Full=Protein 3B; AltName: Full=VPg; Contains: RecName: Full=Picornain 3C; AltName: Full=Protease 3C; Contains: RecName: Full=RNA-directed RNA polymerase 3D-POL; OS=Theiler's murine encephalomyelitis virus (strain DA) (TMEV). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Cardiovirus.
Sequence
MACKHGYPDVCPICTAVDVTPGFEYLLLADGEWFPTDLLCVDLDDDVFWPSNSSNQSETM
EWTDLPLVRDIVMEPQGNASSSDKSNSQSSGNEGVIINNFYSNQYQNSIDLSASGGNAGD
APQNNGQLSNILGGAANAFATMAPLLLDQNTEEMENLSDRVASDKAGNSATNTQSTVGRL
CGYGEAHHGEHPASCADTATDKVLAAERYYTIDLASWTTTQEAFSHIRIPLPHVLAGEDG
GVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKTGDMEPTDPFTM
DTTWRAPQGAPTGYRYDSRTGFFAMNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNIAP
TSSWTQHANWTLVVAVFSPLQYASGSSSDVQITASIQPVNPVFNGLRHETVIAQSPIAVT
VREHKGCFYSTNPDTTVPIYGKTISTPNDYMCGEFSDLLELCKLPTFLGNPNSNNKRYPY
FSATNSVPTTSLVDYQVALSCSCMCNSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFL
IAYTPPGAGKPTTRDQAMQATYAIWDLGLNSSFVFTAPFISPTHYRQTSYTSATIASVDG
WVTVWQLTPLTYPSGAPVNSDILTLVSAGDDFTLRMPISPTKWAPQGSDNAEKGKVSNDD
ASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNIESTFVYQENDLRLNCLLLTPLP
SFCPDSTSGPVKTKAPVQWRWVRSGGTTNFPLMTKQDYAFLCFSPFTYYKCDLEVTVSAL
GTDTVASVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWLVGAGNTQISFVVPYNSPLS
VLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSASVRIRYKKMKVFCPRPTLFFPW
PVSTRSKINADNPVPILELENPAAFYRIDLFITFIDEFITFDYKVHGRPVLTFRIPGFGL
TPAGRMLVCMGEKPAHGPFTSSRSLYHVIFTATCSSFSFSIYKGRYRSWKKPIHDELVDR
GYTTFGEFFRAVRAYHADYYKQRLIHDVEMNPGPVQSVFQPQGAVLTKSLAPQAGIQNLL
LRLLGIDGDCSEVSKAITVVTDLFAAWERAKTTLVSPEFWSKLILKTTKFIAASVLYLHN
PDFTTTVCLSLMTGVDLLTNDSVFDWLKNKLSSFFRTPPPVCPNVLQPQGPLREANEGFT
FAKNIEWAMKTIQSIVNWLTSWFKQEEDHPQSKLDKFLMEFPDHCRNIMDMRNGRKAYCE
CTASFKYFDELYNLAVTCKRIPLASLCEKFKNRHDHSVTRPEPVVVVLRGAAGQGKSVTS
QIIAQSVSKMAFGRQSVYSMPPDSEYFDGYENQFSVIMDDLGQNPDGEDFTVFCQMVSST
NFLPNMAHLERKGTPFTSSFIVATTNLPKFRPVTVAHYPAVDRRITFDFTVTAGPHCTTS
NGMLDIEKAFDEIPGSKPQLACFSADCPLLHKRGVMFTCNRTKAVYNLQQVVKMVNDTIT
RKTENVKKMNSLVAQSPPDWEHFENILTCLRQNNAALQDQLDELQEAFAQARERSDFLSD
WLKVSAIIFAGIASLSAVIKLASKFKESIWPSPVRVELSEGEQAAYAGRARAQKQALQVL
DIQGGGKVLAQAGNPVMDFELFCAKNMVAPITFYYPDKAEVTQSCLLLRAHLFVVNRHVA
ETEWTAFKLKDVRHERDTVVTRSVNRSGAETDLTFIKVTKGPLFKDNVNKFCSNKDDFPA
RNDAVTGIMNTGLAFVYSGNFLIGNQPVNTTTGACFNHCLHYRAQTRRGWCGSAVICNVN
GKKAVYGMHSAGGGGLAAATIITRELIEAAEKSMLALEPQGAIVDISTGSVVHVPRKTKL
RRTVAHDVFQPKFEPAVLSRYDPRTDKDVDVVAFSKHTTNMESLPPVFDIVCDEYANRVF
TILGKDNGLLTVEQAVLGLPGMDPMEKDTSPGLPYTQQGLRRTDLLNFNTAKMTPQLDYA
HSKLVLGVYDDVVYQSFLKDEIRPLEKIHEAKTRIVDVPPFAHCIWGRQLLGRFASKFQT
KPGLELGSAIGTDPDVDWTPYAAELSGFNYVYDVDYSNFDASHSTAMFECLIKNFFTEQN
GFDRRIAEYLRSLAVSRHAYEDRRVLIRGGLLSGCAATSMLNTIMNNVIIRAALYLTYSN
FEFDDIKVLSYGDDLLIGTNYQIDFNLVKERLAPFGYKITPANKTTTFPLTSHLQDVTFL
KRRFVRFNSYLFRPQMDAVNLKAMVSYCKPGTLKEKLMSIALLAVHSGPDIYDEIFLPFR
NVGIVVPTYSSMLYRWLSLFR
Download sequence
Identical sequences P13899
POLG_TMEVD

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]