SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q007D6_IBDV from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q007D6_IBDV
Domain Number 1 Region: 2-219
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 9.77e-98
Family Birnaviridae-like VP 0.00000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q007D6_IBDV
Sequence length 220
Comment AC=Q007D6; DE=SubName: Full=VP2; Flags: Fragment; OS=Avian infectious bursal disease virus (IBDV) (Gumboro disease virus). OC=Viruses; dsRNA viruses; Birnaviridae; Avibirnavirus.
Sequence
NYQFSSQYQSGGVTITLFSANIDAITSLSVGGELVFKTSVQNLVLGATIYLIGFDGTAVI
TRAVAANNGLTAGIDNLMPFNIVIPTNEITQPITSIKLEIVTSKSGGQEGEQMSWSASGS
LAVTIHGGNYPGALRPVTLVAYERVATGSVVTVAGVSNFELIPNPELAKNLVTEYGRFDP
GAMNYTKLILSERDRLGIKTVWPTREYTDFREYFMEVADL
Download sequence
Identical sequences Q007D6
Q007D6_IBDV

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]