SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q00MX7_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q00MX7_9PICO
Domain Number 1 Region: 1719-2179
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.46e-112
Family RNA-dependent RNA-polymerase 0.0000169
Further Details:      
 
Domain Number 2 Region: 277-538
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0046
Further Details:      
 
Domain Number 3 Region: 33-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.26e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0021
Further Details:      
 
Domain Number 4 Region: 565-763
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.4e-28
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.013
Further Details:      
 
Domain Number 5 Region: 1518-1704
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.85e-27
Family Viral cysteine protease of trypsin fold 0.026
Further Details:      
 
Domain Number 6 Region: 1153-1309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000172
Family RecA protein-like (ATPase-domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q00MX7_9PICO
Sequence length 2183
Comment AC=Q00MX7; DE=SubName: Full=Polyprotein; OS=Human parechovirus 4. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKGIADMATGITKTIDSTVNTVNETITNPNNAAGGDMLTKVADDASNVLGPNCFATT
STPENKDVVQATTTVNTTNLTQHPSAPTMPFTPDFRNVDMFHSMAYDVTTGDKNPSKLIR
LRTEFWERTYARQHLIVDVELPHAFWDNTNKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPAVTHSDKMEFGAFTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDL
GRLRVYVWAPLTIPSGATSTVDVTVLGSLLQLDFQNPRVYNTQVDIYDNNNDTRAKQIRK
KKWLTMSTKYKWTRNKIDIAEGPGAMNMANVLSTTGAQSVALVGERAFYDPRTAGSKSRF
DDLVKIAQLFSVMSDSTTPSASSGIDDKGYFEWKATATPQTVIHRNVVKLNQFPNLNMFV
NSYSYFRGSLIIRLSVYASTFNRGRLRMGFFPNFTTNTTSEIDNSIYTICDIGSDNSFEI
TIPYTFSTWMRKTNGHALGLFQIEVLNRLTYNSSSPSSVHCIVQGRLGNDAKFFCPAGSL
VTFQNSWGSQMDLTDPLCIEDDCTEDCKQTISPDELGLTSAQDDGPLGGEKPNYFLNFRA
VNVDIFTVSHTKVDNIFGRAWFAYDHTYRDEGTWRQALDFPKKGHGALTQLFAYYSGELN
IHVLFLSETGFLRVAHTYDSDTNRSDFFSSNGVITVPAGEQMTLSVPFYSSKPLRTIRDS
AALGYVMCKPFMSGTTGGKIEIYLSLRCPNLFFPLPAPKPATSRALRGDMANFSDQSLYD
QQPQGQVMKLAYLDRGFYKHYGIIVGESVYQLDSDDIFKTALTGKAKFTKTKLTPDWIIE
EECELDYFRVKYLESSVNSEHIFSVDHNCETIAKDIFGTHTLSQHQAIGLIGTILLTAGL
MSTIKTPVNATTIKEFFNHAVDGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILV
RILCYMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAE
SMSNTDDEEIKEQICDTVKYTKSILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLS
VFKPSMESKAIQWLERNKEHVCAILDYASDIIVESKDQTKMKSQEFYQKYTDCLAKFKPI
MAICFRSCHNSISNTVYRLFQELARIPSRISTQNDLIRVEPIGVWIQGEPGQGKSFLTHT
LSRQLQKSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFI
VPMAHLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKAGKL
NVSQAMSTMATGECWEVSKNGRDWETLKLKDLVQKITEDYQERQKNYNCWKQQLENQTLD
DLDDAVSYIKHNFPDAVPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFATKVASQTRKA
AKEVVDWFSSKIKSMLSFVEKNKAWLTVVSAVTSAISILLLVTKIFKKEDSKDERAYNPT
LPVAKPKGTFPVTQREFKNEAPYDGQLEHIISQMAYITGSTTGHLTHCAGYQHDEIILHG
HSIKYLEQEENLTLHYKNKVFPIENPSVTQVTLGGKPMDLAILKCRLPFRFKKNSKYYTN
KIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGTCGGLLISK
VEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEVTPIQPMYINTKSQIHKSPVY
GAVEVKMGPAVLSKSDPRLEEPVECLIKKSAAKYRVNKFQVNNELWQGVKACVKSKFREI
FGINGIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKKDLICLEPFSVSPMLEKLVQD
KFHALLKGNQISTIFNTCLKDELRKLDKISAGKTRCIEACEVDYCIVYRMIMMEIYDKIY
QTPCYYSGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDS
PDLVMQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGID
CLPIVYGDDVILSLDKEIDPEKLQSIMADSFGAEVTGSRKDEPPSLKPRLEVEFLKRKPG
YFPESTFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYLHYIKILDPYL
KEWNITVDDYDVVIAKLMPMVFD
Download sequence
Identical sequences Q00MX7
Q00MX7_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]