SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q0VYC9_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q0VYC9_9PICO
Domain Number 1 Region: 1721-2179
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.04e-112
Family RNA-dependent RNA-polymerase 0.0000183
Further Details:      
 
Domain Number 2 Region: 33-278
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.2e-50
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0021
Further Details:      
 
Domain Number 3 Region: 279-538
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.52e-49
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0046
Further Details:      
 
Domain Number 4 Region: 1518-1704
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.95e-28
Family Viral cysteine protease of trypsin fold 0.026
Further Details:      
 
Domain Number 5 Region: 565-758
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.91e-28
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.013
Further Details:      
 
Domain Number 6 Region: 1154-1320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000113
Family RecA protein-like (ATPase-domain) 0.079
Further Details:      
 
Weak hits

Sequence:  Q0VYC9_9PICO
Domain Number - Region: 930-1174,1393-1461
Classification Level Classification E-value
Superfamily ARM repeat 0.0432
Family MIF4G domain-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q0VYC9_9PICO
Sequence length 2183
Comment AC=Q0VYC9; DE=SubName: Full=Polyprotein; OS=Human parechovirus 4. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Parechovirus.
Sequence
METIKGITDMAAGITKTIDSTVNTVNEIITNPSNAAGGDMLTKVADDASNVLGPNCFATT
STPENKDVVQATTTVNTTNLTQHPSAPTMPFTPDFRNVDIFHSMAYDVTTGDKNPSKLIR
LETEYWERTYARQHLIVDVELPHAFWDNTNKPAYGQSRYFAAVRCGFHFQVQVNVNQGTA
GSALVVYEPKPAVTHSDKMEFGAFTNLPHVLMNLAETTQADLCIPYVSDTNYVKTDSSDL
GRLRVYVWAPLTIPSGATSTVDVTVLGSLLQLDFQNPRVYNTQVDIYDNNNETRARQIRK
KKWLTMSTKYKWTRSKIDIAEGPGAMNMANVLSTTGAQSVALVGERAFYDPRTAGSKSRF
DDLVKIAQLFSVMSDSTTPSTSSGIDDKGYFEWKATATPQTVIHRNVVKLNQFPNLNMFV
NSYSYFRGSLIIRLSVYASTFNRGRLRMGFFPNFTTNTTSEIDNSIYTICDIGSDNSFEI
TIPYTFSTWMRKTNGHALGLFQIEVLNRLTYNSSSPSSVHCIVQGRLGNDAKFFCPAGSL
VTFQNSWGSQMDLTDPLCIEDDCTEDCKQTISPDELGLTSAQDDGPLGGEKPNYFLNFRA
VNVDIFTVSHTKVDNIFGRAWFAYDHTYRDEGTWRQALDFPKKGHGALTQLFAYYSGELN
IHVLFLSETGFLRVAHTYDSDTNRSDFFSSNGVITVPAGEQMTLSVPFYSSKPLRTIRDS
AALGYVMCKPFMSGTTGGKIEIYLSLRCPNLFFPLPAPKPTSGRSLRGDMAQLVNQSPYN
ITPVNQTMKLAYLDRGFYKHYGIIVGDNVYQLDSDDIFKTALTGKAKFTKSKLTADWVVE
EECELDYFRVKYLESSVNSEHIFSVDKNCETIAKDIFGTHTLSQHQAIGLIGTILLTAGL
MSTIQTPVNTTTIKEFFNHAIEGDEQGLSLLVQKCTTFFSSAATEILDNDLVKFIVKILV
RILCYMVLYCHKPNILTTACLSTLLIMDVTSSSVLSPSCKALMQCLMDGDVKKLAEVVAE
SMSNTDDEEIKEQICDTVKYTKSILSNQGPFKGFNEVSTAFRHIDWWIHTLLKIKDMVLS
VFKPSMESKAIQWLERNKEHVCAILDYASDIIVESKDQTKMKSQEFYQKYTDCLTKFKPI
MAICFRSCHNSISNTVYRLFQELARMPSRISTQNDLIRVEPIGVWIQGEPGQGKSFLTHT
LSRQLQKSCKLNGVYTNPTASEFMDGYDNQDIHLIDDLGQTRKEKDIEMLCNCISSVPFI
VPMAHLEEKGKFYTSKLVIATTNKSDFSSTVLQDSGALKRRFPYIMHIRAAKAYSKSGKL
NISQAMSTMATGECWEVSKNGRDWETLKLKDLVQKITEDYQERQKNYNCWKQQLENQTLD
DLDDAVSYIKYNFPDAIPYIDEYLNIEMSTLIEQMEAFIEPRPSVFKCFATKVANHTRKA
AKEVVDWFSNKIKSMLSFVERNKAWLTVVSAVTSAISILLLVTKIFKKEDSKDERAYNPT
LPVTKPKGAFPVTQREFKNEAPYDGQLEHIITQMAYITGSTTGHLTHCAGYQHDEIILHG
HSIKYLEQEEDLILHYKNKVFPIENPSVTQVTLGGKPMDLAILKCKLPFRFKKNSKYYTN
KIGTESMLIWMTEQGIITKEVQRVHHSGGIKTREGTESTKTISYTVKSCKGMCGGLLISK
VEGNFKILGMHIAGNGEMGVAIPFNFLKNDMSDQGIVTEATPIQPMYINTKTQIHKSPVY
GAVEVKMGPAVLSKSDPRLEEPVECLIKKSAAKYRVNKFQVNNELWQGVKACVKSKFREI
FGINGIVDMKTAILGTSHVNSMDLSTSAGYSFVKSGYKKRDLICLEPFFVSPMLEKLVQD
KFHALLKGNQITTIFNTCLKDELRKLDKISAGKTRCIEACEVDYCIVYRMIMMEIYDKIY
QTPCYYSGLAVGINPYKDWHFMINALNDYNYEMDYSQYDGSLSSMLLWEAVEVLAYCHDS
PDLVMQLHKPVIDSDHVVFNERWLIHGGMPSGSPCTTVLNSLCNLMMCIYTTNLISPGID
CLPIVYGDDVILSLDKEIDPEKLQSIMADSFGAEVTGSRKDEPPSLKPRMEVEFLKRKPG
YFPESTFIVGKLDTENMIQHLMWMKNFSTFKQQLQSYLMELCLHGKDTYLHCIKILDPYL
KEWNIIVDDYDVVIAKLMPMVFD
Download sequence
Identical sequences Q0VYC9
Q0VYC9_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]