SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q2XPZ2_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q2XPZ2_9PICO
Domain Number 1 Region: 1787-2243
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.26e-113
Family RNA-dependent RNA-polymerase 0.00000000163
Further Details:      
 
Domain Number 2 Region: 11-203
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.57e-80
Family FMDV leader protease 0.00016
Further Details:      
 
Domain Number 3 Region: 210-514
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1e-75
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000699
Further Details:      
 
Domain Number 4 Region: 552-746,780-969
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.11e-51
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000103
Further Details:      
 
Domain Number 5 Region: 1586-1779
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.66e-45
Family Viral cysteine protease of trypsin fold 0.0000309
Further Details:      
 
Domain Number 6 Region: 1244-1380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000284
Family ABC transporter ATPase domain-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q2XPZ2_9PICO
Sequence length 2248
Comment AC=Q2XPZ2; DE=SubName: Full=Polyprotein; OS=Equine rhinitis A virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MMAASKVYRVCEQTLLAGAVRMMDKFLQKRTVFVPHLDKTIRLTGLHNYDNTCWLNALTQ
LTQILGIRLFDEHFGNRGLFTRKTIDWVSDQTGIKDLKSGAPPLVVVYKLWQHGHLDVGT
MEKPRSITLWSGPKVCLSDFWACVSAKPGHAVFYLLTSEGWICVDDKKIYPETPKTEDVL
VFAPYDFESLGKDPPKLHQRYEKAFERLSGAGTSTPTTGNQNMSGNSGSIVQNFYMQQYQ
NSIDADLGDNVISPEGQGSNTSSSTSSSQSSGLGGWFSSLLNLGTKLLADKKTEETTNIE
DRIETTVVGVTIINSQGSVGTTYCYSKPDGRPPSTVSDPVTRLGPTLSRHYTFKVGEWPH
SQSHGHAWICPLPGDKLKKMGSFHEVVKAHHLVKNGWDVVVQVNASFAHSGALCVAAVPE
YEHTHEKAVKWSELEEPAYTYQQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLAFHNP
WTIVILILSELTGPGQMEPVTMSEAPIDAMVNGPLPNPEAPIRVVSVPESDSFMSSVPDN
STPLYPKVVVPPRQVPGRFTNFIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLS
AAELHGTYVASLSSFFAQYRGSLNFNFIFTGAAATKAKFLVAFVPPHSAAPKTRDEAMAC
IHAVWDVGLNSAFSFNVPYSSPADFMAVYSAEATVVNVSGWLQVYALTALTSTDIAVNSK
GRVLVAVSAGPDFSLRHPVDLPDKQVTNVGEDGEPGETEPRYALSPVDMHVHTDVSFLLD
RFFDVETLELSNLTGSPNTHVLNPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPS
SVGEGFVWVKWFPVGAPTKTTDAWQLEGGGNSVRIQQLAVAGMSPTVVFKIAGSRSQACG
FSVPYTSMWRVVPVFYNGWGAPTKEKATYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPR
ASMYCPRPIAPAFTRPADKTRHKFPTNINKQCTNYSLLKLAGDVESNPGPTIFSKASADL
NALSTSLGELTGMLKDLKAKAETYSPFYKMAKMLFKLATLAVAAMRTKDPVVVVMLIADF
GLEVFDTGFFFSYFQEKLQPYMKTIPGKISDLVTDAATAAAQIPKGVYSFVSSFFETPEG
VVEKQVSLRTVNDIFTLLKNSDWFIKTLVALKKWLTSWFAQEQQADDALYSELEKYPLYK
LKLKEPDTQKEARQWFKDMQQRALAVKDKGLFSLLQIPLVDLPQSRPEPVVCVLRGASGQ
GKSYLANLMAQAISLLLVGKQNSVWSCPPDPTYFDGYNGQAVVIMDDLGQNPNGADFKYF
CQMVSTTAFVPPMAHLDDKGIPFTSPVVICTTNLHSSFTPITVSCPEALKRRFRFDVTVS
AKPGFVRTVGSNQLLNLPLALKPAGLPPHPIFENDMPIINGQAVKLALFGGEVTAFELIE
MILSEVQNRQDTHKMPIFKQSWSDLFRKCTTDEEQEMLQFLIDNKDSEILRAFVSERSIL
LHEEYLKWESYMTRRAKFHRLAADFAMFLSILTSLIVIFCLVYSMYQLFKTPDEHSAYDP
STKPKPKTQEVKTLKIRTETGVPATDLQQSIMKNVQPIELYFDNELVTDCSALGVYDNSY
LVPLHLFEFDFDTIVLGGRHYKKAECEKVEFELEVNGDMVSSDACLLRVPSGPKVRNIVH
LFTNEIELKKMTQVTGIMNSPHQARTVFFGSFLTVRKSILTSDGTVMPNVLSYAAQTSRG
YCGAAIVAGSPARIIGIHSAGTGSVAFCSLVSKDALERTLPQKQGNVSRLDDDVRVSVPR
RSKLVKSLAYPIFKPDYGPAPLSQFDKRLSDGVKLDEVVFAKHTGDKEISAQDQKWLLRA
AHVYAQKVFSRIGFDNQALTEKEAICGIPGLDKMEQDTAPGLPYAQQNKRRKDICDFEEG
RLKGAAKFQKDRFMAGDYSDLIYQSFLKDEIRPLEKVRAGKTRLIDVPPMPHVVVGRQLL
GRFVAKFHEANGFDIGSAIGCDPDVDWTRFGLELERFRYVYACDYSRFDANHAADAMRVV
LNYFFSEDHGFDPGVPAFIESLIDSVHAYEEKRYNIYGGLPSGCSCTSILNTILNNVYIL
AAMMKAYENFEPDDIQVICYGDDCLIASDFEIDFQQLVPVFSSFGQVITTADKTDFFKLT
TLSEVTFLKRAFVPDGAFYKPVMDVKTLEAILSFVRPGTQAEKLLSVAQLAGHCEPEQYE
RLFEPFVGMYFVPTWRDLRLQWLMKLGC
Download sequence
Identical sequences Q2XPZ2
Q2XPZ2_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]