SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q30D45_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q30D45_9CALI
Domain Number 1 Region: 25-83
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.0000000000000082
Family Caliciviridae-like VP 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q30D45_9CALI
Sequence length 83
Comment AC=Q30D45; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/GII/GpC/2004/Irl. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDANPSDGSSANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAP
GGEFTVSPRNAPGEILWSAPLGP
Download sequence
Identical sequences Q30D45
Q30D45_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]