SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q3LDY8_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q3LDY8_9CALI
Domain Number 1 Region: 15-79
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.37e-18
Family Caliciviridae-like VP 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q3LDY8_9CALI
Sequence length 79
Comment AC=Q3LDY8; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/Chiba/030522/2003/JP. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
SNDGAAGLVPEVNNETMALEPVAGASIAAPLTGQNNVIDPWIRLNFVQAPNGEFTVSPRN
SPGEILLNLELGPELNPYL
Download sequence
Identical sequences Q3LDX9 Q3LDY8
Q3LDX9_9CALI Q3LDY8_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]