SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q4U6H1_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q4U6H1_9CALI
Domain Number 1 Region: 26-101
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.73e-25
Family Caliciviridae-like VP 0.0000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q4U6H1_9CALI
Sequence length 103
Comment AC=Q4U6H1; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Norovirus Hu/GI/FH-A/2004/South Korea. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
SKDAPTSPDGASGAGQLVPEANTAEQISMDSVAGASTAVATAGQVNMIDPWIFNNFVQAP
QGEFTISPNNTPGDILFDLQLGPHLNPFPAHLSQMYNGWVGHG
Download sequence
Identical sequences Q4U6H1
Q4U6H1_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]