SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q56FN1_9ENTO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q56FN1_9ENTO
Domain Number 1 Region: 118-256
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.83e-61
Family Viral cysteine protease of trypsin fold 0.0001
Further Details:      
 
Domain Number 2 Region: 4-104
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.6e-36
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000112
Further Details:      
 
Domain Number 3 Region: 450-630
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000519
Family Nucleotide and nucleoside kinases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q56FN1_9ENTO
Sequence length 692
Comment AC=Q56FN1; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Human echovirus 6. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Enterovirus; Human enterovirus B.
Sequence
MLHPGMSIPFMSVGNAYSNFYDGWSHFSQTGVYGFNTLNNMGKLYFRHVNDKTISPITSK
VRIYFKPTQVEARVPRPPRLCEYTHKDNVDFEPKGVTTSRTQLTISNSTHMENYGAFGQQ
SGAVYVGNYRLVNRHLATHNDWKNCVWEDYNRDLLVSTTTAHGCDTIARCQCTTGVYFCQ
SKKKHYPVSFEGPGLVEVQESEYYPKRYQSHVLLAVGFSEPGDCGGILRCEHGVIGIVTM
GGEGVVGFADVRDLLWLEDDAMEQGVKDYVEQLGNAFGSGFTNQISEQVNLLKESLVGQD
SILEKSLKALVKIISALVIVVRNHDDLITVTATLALIGCTTSPWRWLKHKVSQYYGIPMA
ERQNNNWLKKFTEMTNACKGMEWIAIKIQKFIEWLKIKILPEVKEKHEFLNRLKQLPLLE
SQIATIEQSAPSQSDQEQLFSNVQYFAHYCRKYAPLYAAEAKRVFSLEKKMSNYIQFKSK
CRIEPVCLLLHGCPGAGKSVATNLIGRSLAEKLNSSVYSLPPDPDHFDGYKQQAVVIMDD
LCQNPDGKDVSLFCQMVSSVDFVPPMAALEEKGILFTSPFVLASTNAGSINAPTVSDSRA
LARRFHXDMNIEVISMYSQNGKINMPMSVKTCDEECCPTNFKKCCPLVCGKAIQFIDRRT
QVRYSLDMLVTEMFREYNHRHTVGATLEALFQ
Download sequence
Identical sequences Q56FN1
Q56FN1_9ENTO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]