SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q5YJA8_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q5YJA8_9PICO
Domain Number 1 Region: 75-373
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.03e-106
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000617
Further Details:      
 
Domain Number 2 Region: 411-607,662-874
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.73e-94
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000132
Further Details:      
 
Domain Number 3 Region: 904-1078
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-23
Family Viral cysteine protease of trypsin fold 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q5YJA8_9PICO
Sequence length 1093
Comment AC=Q5YJA8; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Porcine enterovirus 8. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Sapelovirus; Porcine sapelovirus.
Sequence
MESTTTLSFCNWIPKNQRARVYLTTSVTHEKSIGPYTYMVHDMIMKENSRTSLAMAYVEG
KKLVFNTGTQLGQVHSANTGNKPQGAYNHGSGSITQVNYYGSDYSQAWNPTQQQMDPSQF
TKPVTEIAGMVAGPTLKAPDKEEEGYSDRLMQLTAGNSCITTQEAAKAVVAYGQWPSYNI
DGGEHLDLATTPGTAVDRFYTFDSLQWTDTQIGEWSLPLPGGLMDTGVFGQNLRFHYLSR
MGFCVHVQCNASKFHQGALIIAMIPEHQTPTQVSNGFEYRNGVTYQGNNYPTEQLPIFPH
QIINLRTNNSATIVYPYTNCTPAGFGLAHNFVTLVIRVLVPLKYNTGASTFVPITVSVAP
MCSQFAGLRSAVSRQGFPIRQIPGSQQFMTTQRDNGIPIYPEFQKTHGFKLPGRVTNLLQ
VAQVGTFLKFSNNVNDASRIYLNLDITQGNQTARIAAIDVSMVSPHLSTTYLSRLAQMYA
NYRGSVVFEFMFCGSQMATGKLLIAYTPPGGSSPSTRNDAMLATHVIWDIGLQSTCKLVV
PYISSSQYRQNNMTGTTLSYNGWVTVFQQTALVVPPGAPTTCQLVVTVSAADNFALRIPT
DTAYFADYQGDVKEVVQASINKTLQNALTTRPQQEQSSNGIMINQGDAPALTAAETGESD
TNSGGSTMELQATNCTFSLRETALEYLMSRYSLMYEGTLDYTDQAGRRHLTYNLNFRTIG
KSGSDITKFKAFTYWRFDLDVVVMLLEDKPAAVRNLMFQILFTPHGGVIPRQHNSQVWNA
PNSTSVYTRVGNCPASFRIPFMSVCNYYTSFFDGDGNFDQNGAAYGVNPGDFIGTISIRM
ADDFSTNATTGSFRAKIFLRPVNIEAYMPRPLISYKANGDVRQDSSMYYPATQTGPYEVC
QTKNATELTETKWAKYSCSVRFDRGSFTAWFVGEDLLLVPYHAANNWSQTTHVYLWRAWE
KDWRDHPELEMKVPIEDMWTDSTRDLTFLKLSYSSPYWLEMPTKGSAIGDYTVVVNSAHF
PWMQYTGPKPFRHPYLHIGQHTQYRLWMAAGDADNGFCGAGLISKGKLYGIVTAKTECKS
GGTFVAYTELDED
Download sequence
Identical sequences Q5YJA8
Q5YJA8_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]