SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q66775_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q66775_9PICO
Domain Number 1 Region: 1764-2222
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.44e-115
Family RNA-dependent RNA-polymerase 0.00000000176
Further Details:      
 
Domain Number 2 Region: 189-493
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.62e-79
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000619
Further Details:      
 
Domain Number 3 Region: 7-182
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.75e-79
Family FMDV leader protease 0.00017
Further Details:      
 
Domain Number 4 Region: 531-725,759-948
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.9e-52
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000106
Further Details:      
 
Domain Number 5 Region: 1565-1758
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.59e-46
Family Viral cysteine protease of trypsin fold 0.0000251
Further Details:      
 
Domain Number 6 Region: 1190-1362
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000642
Family YjeE-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q66775_9PICO
Sequence length 2227
Comment AC=Q66775; DE=SubName: Full=Polyprotein; OS=Equine rhinitis A virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MMDKFLQKKTVFVPQLDKQVRLTGLHNYDNTCWLNALTQLTQILGIRLFDEHFGNRGLFT
RKTIDWVSDQTGIKDLKSGAPPLVVVYKLWQHGHLDVGTMEKPRSITLWSGPKVCLSDFW
ACVSAKPGHAVFYLLTSEGWICVDDKKIYPETPKTEDVLVFAPYDFESLGKDPPKLHQRY
EKAFERLSGAGTSTPTTGNQNMSGNSGSIVQNFYMQQYQNSIDADLGDNVISPEGQGSNT
SSSTSSSQSSGLGGWFSSLLNLGTKLLADKKTEETTNIEDRIETTVVGVTIINSQGSVGT
TYCYSRPDSKAPSTVSDPVTRLGPTLSRHYTFKVGEWPHSQSHGHAWICPLPGDKLKKMG
SFHEVVKSHHLVKNGWDVVVQVNASFAHSGALCVAAVPEYKHTHEKALKWSELEEPAYTY
QQLSVFPHQLLNLRTNSSVHLVMPYIGPGPTTNLTLHNPWTIVILILSELTGPGQTVPVT
MSVAPIDAMVNGPLPNPEAPIRVVSVPESDSFMSSVPDNSTPLYPKVVVPPRQVPGRFTN
FIDVAKQTYSFCSISGKPYFEVTNTSGDEPLFQMDVSLSAAELHGTYVASLSSFFAQYRG
SLNFNFIFTGAAATKAKFLVAFVPPHTAAPKTRDEAMACIHAVWDVGLNSAFSFNVPYSS
PSDFMAVYSADATVVNVSGWLQVYALTALTSTDIAVNSKGRVLVAVSAGPDFSLRHPVDL
PDKQVTNVGEDGEPGETEPRHALSPVDMHVHTDVSFLLDRFFDVETIELSNLTGSPTTHL
LDPFGSTAQLAWARLLNTCTYFFSDLELSIQFKFTTTPSSVGEGFVWVKWFPVGAPTKTT
DAWQLKGGGNSVRIQKLAVAGLSPTVVFKIAGSRSQACGFNVPYTSMWRVVPVLYNGWGA
PTKEESTYNWLPGAHFGSILLTSDAHDKGGCYLRYRFPRASMYCPRPIPPAFTRPADKTR
HKFPTNINKQCTNYALLKLAGDVESNPGPTIFSKASADLNALSTSLGELTGMLKDLKAKA
ETYSPFYKTAKMLFKLATLAVTAMRTKDPVVVVMLIADFGLEVFDTGFFFSYFQEKLQPY
MKTIPGKISELVTDAATAAAQIPKGVYSFVSSFFETPEGVVEKQVSLRTVNDIFTLLKNS
DWFIKTLVALKKWLTSWFAQEQQADDALYSELEKYPLYKLKLKEPDTQEEARQWFKDMQQ
RALAVKDKGLFSLLQIPLVNLPTSRPEPVVCILRGASGQGKSYLANLMAQAISLLLVGKQ
GSVWSCPPDPTYFDGYNGQAVVIMDDLGQNPNGADFKYFCQMVSTTAFVPPMAHLDDKGI
PFTSPVVICTTNLHSSFTPITVSCPEALKRRFRFDVTVSVKPGFVRTVGSSQLLNLPLAL
KPAGLPPHPIFENDMPILNGQAVKLALSGGEVTAFELIEMILSEVQNRQDTHKMPIFKQS
WSDLFKKCSTDEEQKMLQFLIDNKDSEILRAFVSERSILLHEEYLKWESYMTRRAKFHRL
AADFAMFLSILTSLIVIFCLVYSMYQIFKTPDEHSAYDPATKPKPKTQEIKTLKIRTETG
VPATDLQQSIMKNVQPIELYCDGNLVTDCSALGVYDNSYLVPLHLFEFDFDTIVLGGRQY
KKADCEKVEFELEINGDMVSSDACLLRVPTGPKVRNIVHLFTNEIELKKMTQITGIMNSP
HQARTVFFGSFLTVKKSILTSDGTVMPNVLSYAAQTSRGYCGAAIVAGSPARIIGIHSAG
TGSVAFCSLVSRDALERTLPQKQGNVVRLDDDVRVSVPRRTKLVKSLAYPVFKPDYGPAP
LSQFDKRLADGVKLDEVVFAKHTGDKDISAEDQKWLLRAAHVYAQRVFARIGFDNQALTE
QEAICGIPGLDKMEQDTAPGLPYAQQNKRRKDICDFDKGQLKGAAKLQKDRFMAGDYSDL
VYQSFLKDEIRPLEKVRAGKTRLIDVPPMPHVVVGRQLLGRFVAKFHEANGFETGSAIGC
DPDVDWTRFGLELERYRYVYACDYSRFDANHAADAMRVVLNYFFSEDHGFDPGVPAFIES
LVDSVHAYEEKRFNIYGGLPSGCSCTSILNTVLNNVYILAAMMKAFENFEPDDIQVICYG
DDCLIASDLEIDFQKLVPVFSSFGQVITTADKTDFFKLTTLSEVTFLKRAFVPDGAFYKP
VMDVKTLEAILSFVRPGTQAEKLLSVAQLAGHCEPEQYERLFEPFAGMYYVPTWRDLRLQ
WLMKLGC
Download sequence
Identical sequences Q66775
Q66775_9PICO gi|21328572|ref|NP_653076.1| NP_653076.1.88786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]