SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q68GU3_9ENTO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q68GU3_9ENTO
Domain Number 1 Region: 120-258
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.29e-61
Family Viral cysteine protease of trypsin fold 0.000093
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 8.29e-41
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000413
Further Details:      
 
Domain Number 3 Region: 451-633
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000931
Family Nucleotide and nucleoside kinases 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q68GU3_9ENTO
Sequence length 694
Comment AC=Q68GU3; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Human echovirus 13. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Enterovirus; Human enterovirus B.
Sequence
APARMSIPFISVGNAYSSFYDGWSNFTQNGVYGFNTLNNMGKLYVRHVNGASPGPVKSTI
RIYMKPKHVKAWIPRPPRLCEYEKSGNVNFKPKGVTEARPSIKLEKPSTGGRLVTKGVFG
QQSGAVYLGNYRVVNRHLATHNDWQNCVWEDYNRDLLVSTTTAHGCDTIARCQCTAGVYY
CASRNKHYPVTFEGPGLVEVQESEYYPKRYQSHVLLAAGFSEPGDCGGILRCEHGVIGIV
TMGGEGVVGFADVRDLLWLEDDAMEQGVRDYVEQLGNAFGSGFTNQICEQVNLLKESLVG
QDSILEKSLKALVKIISALVIVVRNHDDLITVTATLALIGCTSSPWRWLKQKVSQYYGIP
MAERQNNGWLKKFTEMTNACKGMEWIAVKIQKFIEWLKVKILPEVKEKHEFLNRLKQLPL
LESQITTIEQSAPSQSDQEQLFSNVQYFAHYCRKYAPLYAAEAKEVFSLEKKMSNYIQFK
SKCRIEPVCLLLHGSPGAGKSVATNLIGRSLAEKLNSSVYSLPPDPDHFDGYKQQAVVIM
DDLCQNPDGKDVSLFCQMVSSVDFVPPMAALEEKGILFTSPFVLASTNAGSINAPTVSDS
RALARRFHFDMNIEVISMYSQNGKINMPMAVKTCDEECCPANFKKCCPLVCGKAIQFIDR
RTQMRYSLDMLVTEMFREYNHRHSVGATLEALFQ
Download sequence
Identical sequences Q68GU3
Q68GU3_9ENTO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]