SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6PN26_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6PN26_9PICO
Domain Number 1 Region: 1868-2330
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.91e-125
Family RNA-dependent RNA-polymerase 0.0000000000000238
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.1e-90
Family FMDV leader protease 0.000000016
Further Details:      
 
Domain Number 3 Region: 541-916
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.21e-78
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000132
Further Details:      
 
Domain Number 4 Region: 216-494
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 6.01e-74
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000836
Further Details:      
 
Domain Number 5 Region: 1655-1851
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.39e-54
Family Viral cysteine protease of trypsin fold 0.0000000103
Further Details:      
 
Domain Number 6 Region: 1106-1341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000101
Family Nitrogenase iron protein-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q6PN26_9PICO
Sequence length 2331
Comment AC=Q6PN26; DE=SubName: Full=Polyprotein; OS=Foot-and-mouth disease virus - type A. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MNTTDCFIALVHAIREIRALFLPRTTGKMELTLHNGEKKTFYSRPNNHDNCWLNTILQLF
RYVDEPFFDWVYNSPENLTLEAIKQLEELTGLELHEGGPPALVIWNIKHLLHTGIGTASR
PSEVCMVDGADMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEEFYPWTPDPSDVLVF
VPYDQEPLNGDWKAMVQRKLKGAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLG
DNAISGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFTGLFGALLADKKTEETTLLEDRI
LTTRNGHTISTTQSSVGVTYGYSTGEDHVAGPNTSGLETRVVQAERFFKKFLFDWTTDKP
FGHLEKLELPTGHHGVFGHLVESYAYMRNGWDVEVSAVGNQFNGGCLLVAMVPEWKEFEQ
REKYQLTLFPHQFISPRTNMTAHITVPYLGVNRYDQYKKHKPWTLVVMVVSPLTVSDTAA
AQIKVYANIAPTYVHVAGELPSKEGIFPVACSDGYGGLVTTDPKTADPAYGKVYNPPRTN
YPGRFTNLLDVAEACPTLLCFDDGKPYVVTRTDDTRLLAKFDVSLAAKHMSNTYLSGIAQ
YYAQYSGTINLHFMFTGSTDSKARYMVAYIPPGVEAPPDTPERAAHCIHAEWDTGLNSKF
TFSIPYVSAADYAYTASDTAETTNVQGWVCIYQITHGKAENDTLVVSVSAGADFELRLPI
DPRQQTTAVGESADPVTTTVEAYGGETQVQRRHHTDVGFIMDRFVKINSLSPTHVIDLMQ
THQHGLVGALLRAATYYFSDLEIVVRHDGNLTWVPNGAPEAALLNTSNPTAYNKAPFTRL
ALPYTAPHRVLATVYNGTNKYSTGGPGRGDMGSLAARVAKQLPASFNYGAIRAENIHELL
VRMKRAELYCPRPLLAIEVSSQDRHKQKIIAPAKQLLNFDLLKLAGDVESNPGPFFFSDV
RSNFSKLVETINQMQEDMSTKHGPDFNRLVSAFEELATGVKAIRTGLDEAKPWYKLIKLL
SRLSCMAAVAARSKDPVLVAIMLADTGLEILDSTFVVKKISDSLSSLFHVPAPAFSFGAP
ILLAGLVKVASSFFRSTPEDLERAEKQLKARDINDIFAILKNGEWLVKLILAIRDWIKAW
VASEEKFVTMTDLVPGILEKQRDLNDPSKYKEAKEWLDNARQACLKSGNVHIANLCKVVA
PAPSKSRPEPVVVCLRGKSGQGKSFLANVLAQAISTHFTGKTDSVWYCPPDPDHFDGYNQ
QTVVVMDDLGQNPDGKDFKYFAQMVSTTGFIPPMASLEDKGKPFNSKVIIATTNLYSGFT
PRTMVCPDALNRRFHFDIDVSARDGYKINNKLDITKALEDTHTNPVAMFKYDCALLNGMA
VEMKRMQQDMFKPQPPLQNVYQLVQEVIERVELHEKVSSHPIFKQISIPSQKSVLYFLIE
KGQHEAAIEFFEGMVHDSIKEELRPLIQQTSFVKRAFKRLKENFEIVALCLTLLANIVIM
IRETRKRQQMVDDAVNEYIERANITTDDKTLDEAEKNPLETSGVSTVGFRERTLPGQASD
DVNSEPVKPVEEQPQAEGPYAGPLERQKPLKVRARLPQQEGPYAGPLERQKPLKVKARAP
VVKEGPYEGPVKKPVALKVKAKNLIVTESGAPPTDLQKMVMGNTKPVELILDGKTVAICC
ATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLHR
GNRVRDITKHFRDTARMKKGTPVVGVINNADVGRLIFSGEALTYKDIVVCMDGDTMPGLF
AYRAATKAGYCGGAVLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLLKMKAHIDPEPHH
EGLIVDTRDVEERVHVMRKTKLAPTVAHGVFNPEFGPAALSNKDPRLNEGVVLDEVIFSK
HKGDTKMSEEDKALFRRCAADYASHLHSVLGTANAPLSIYEAIKGVDGLDAMEPDTAPGL
PWALQGKRRGALIDFENGTVGPEVEAALKLMEKREYKFVCQTFLKDEIRPMEKVRAGKTR
IVDVLPVEHILYTRMMIGRFCAQMHSNNGPQIGSAVGCNPDVDWQRFGTHFAQYRNVWDV
DYSAFDANHCSDAMNIMFEEVFRTDFGFHPNAEWILKTLVNTEHAYENKRIAVEGGMPSG
CSATSIINTILNNIYVLYALRRHYEGVELDTYTMISYGDDIVVASDYDLDFEALKPHFKS
LGQTITPADKSDKGFVLGHSITDVTFLKRHFHMDYGTGFYKPVMASKTLEAILSFARRGT
IQEKLISVAGLAVHSGPDEYRRLFEPFQGLFEIPSYRSLYLRWVNAVCGDA
Download sequence
Identical sequences Q6PN26
Q6PN26_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]