SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q6UV30_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q6UV30_9PICO
Domain Number 1 Region: 1854-2316
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.43e-123
Family RNA-dependent RNA-polymerase 0.0000000000000262
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.36e-90
Family FMDV leader protease 0.0000000162
Further Details:      
 
Domain Number 3 Region: 216-497
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 9.53e-80
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000103
Further Details:      
 
Domain Number 4 Region: 541-917
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.72e-77
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000966
Further Details:      
 
Domain Number 5 Region: 1641-1837
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.33e-53
Family Viral cysteine protease of trypsin fold 0.0000000123
Further Details:      
 
Domain Number 6 Region: 1106-1341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000038
Family Nitrogenase iron protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q6UV30_9PICO
Sequence length 2317
Comment AC=Q6UV30; DE=SubName: Full=Polypeptide; OS=Foot-and-mouth disease virus - type O. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MNTTDCFIALVHALREIKTLFLSRTQGKMEFTLYNGEKKTFYSRPNNHDNCWLNTILQLF
RYVDEPFFDWVYNSPENLTLEAIRQLEEVTGLELHEGGPPALVIWNIKHLLHTGIGTASR
PSEVCMVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVF
VPYDQEPLNGEWKTKVQKRLKGAGQSSPATGPQNQSGNTGSIINNYYMQQYQNSMDTQLG
DNAISGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFSGLFGALLADKKTEETTLLEDRI
LTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDS
FGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSVNK
RELYQPTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNNEGA
PQIKVYANIAPINVHVAGEFPSKEGIFPVACNDGYGGLVTTDPKTADPVYGKVFNPPRNL
LPGRFTNLLDVAEACPTFLHFEGDVPYVTTKTDSDRVLAQFDLSLAAKHMSNTFLAGLAQ
YYAQYSGTINLHFMFTGPTDAKARYMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFT
FSIPYLSAADYAYTASDTAETTNVQGWVCLFQITHGKADGDALVVLASAGKDFELRLPVD
ARTQTTSLGESAVPITATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLMQI
PAHTLVGALLRAATYYFSDLELAVKHKGDLTWVPNGAPEEALNNTTNPTAYHKAPLTRLA
LPYTAPHRVLATVYNGSCRYNNSNVSNVRGDLQVLAQKAARALPTSFNYGAIKATRVTEL
LYRMKRAETYCPRPLLAIHPSEARHKQKIVAPAKQLLNFDLLKLAGDVESNPGPFFFSDV
RSNFTKLVDTINQMQEDMSTKHGPDFNRLVSAFEELATGVKAIRTGLDEAKPWYKLIKLL
SRLSCMTAVAARSKDPVLVAIMLADTGLEILDSTFVVKKISDSLSSLFHVPAPVFSFGAP
ILLAGLVKVASSFFRSTPEDLERAEKQLKARDINDIFAILKNGEWLVKLILAIRDWIKAW
IASEEKFVSMTDLVPGILEKQRDLNDPSKYKEAKEWLDNTRQACLKSGNVHIANLCKVVA
PAPSKPRPEPVVVCLRGKSGQGKSFLANVLAQAVSTHFTGRTDSVWYCPPDPDHFDGYNQ
QTVVVMDDLGQNPDGKDFKYFAQMVSTTGFIPPMASLEDKGKPFNSKVIIATTNLYSGFT
PRTMVCPDALNRRFHFDIDLSAKDGYKINNKLDITKALEDTHTNPVAMFQYDCALLNGMA
VEMKRMQQDMFKPQPPLQNVYQLVQEVIERVELHEKVSSHPIFKQISIPSRKSVLYFLIE
KGQHEAAIEFFEGMVHDSIKEELRPLIQQTSFVKRAFKRLKENFEIVALCLTLLANIVIM
IRETRKRQQMVDDAVNEYIETANITTDDKTLDEAEKNPLETSGASTVGFRERTLPEREQP
QSEGPYAGPLERQKPLKVRAKLPQQEGPYAGPMERQKPLKVKAKAPVVKEGPYEGPVKKP
VALKVKAKNLIVTESGAPPTDLQKMVMGNTKPVELILDGKTVAICCATGVFGTAYLVPRH
LFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALIVLHRGNRMRDITKHFRDV
ARMKKGTPVVGVINNADVGRLIFSGEALTYKDIVVCMDGDTMPGLFAYRAATKAGYCGGA
VLAKDGADTFIVGTHSAGGNGVGYCSCVSRSMLLKMKAHIDPEPHHEGLIVDTRDVEERV
HVMRKTKLAPTVAHGVFNPDFGPAALSNKDPRLNEGVVLDEVIFSKHKGDTKMSEEDKAL
FRRCAADYASRLHSELGTANAPLSIYEAIKGVDGLDAMEPDTAPGLPWALQGKRRGALID
FENGTVGPEVEAALKLMEKREYKFACQTFLKDEIRPMEKVRADKTRIVDVLPVEHILYTR
MMIGRFCAQMHSNNGPRIGSAVGCNPDVDWQRFGTHFAQYRNVWDVDYSAFDANHCSDAM
NIMFEEVFNTEFGFHPNAEWILKTLVNTEHAYENKRITVEGGMPSGCSATSIINTILNNI
YVLYALRRHYEGVELDTYTMVSYGDDIVVASDYDLDFEALKPHFKSLGQTITPADKSDKG
FALGHSITDVTFLKRHFHMDYGTGFYKPVMASKTLEAILSFARRGTIQEKLISVAGLAVH
SGPDEYRRLFEPFQGLFEIPSYRSLYLRWVNAVCGDA
Download sequence
Identical sequences Q6UV30
Q6UV30_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]