SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q70GZ8_FOWPV from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q70GZ8_FOWPV
Domain Number 1 Region: 73-443
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.46e-80
Family Ankyrin repeat 0.00000257
Further Details:      
 
Domain Number 2 Region: 13-100
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000589
Family Pseudo ankyrin repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q70GZ8_FOWPV
Sequence length 603
Comment AC=Q70GZ8; DE=SubName: Full=Putative uncharacterized protein fp9.162; GN=Name=fp9.162; OS=Fowlpox virus (isolate HP-438[Munich]). OC=Viruses; dsDNA viruses, no RNA stage; Poxviridae; Chordopoxvirinae; OC=Avipoxvirus.
Sequence
MVIYCNLHTVIMNIFYNNIHRCFKDTPLHKAVMLPDAVERIRMFVSKGADINVISDFKKT
ALHYAAKKLATPEVLKTLIYLGTNVNVTDMFESTPLHYAVQENGLEATKKLLDLGADPNT
KYMNGQTPLHCAAMVIPDGPELVRILVEYGANVNALDNKHNTPLALAAELSNTNKTIETL
IELGADVKIKNNDGITPLHLAAKSSSDSKTVETLILHGADVNATCSEGNTPLHDAATSYE
LSNTIEMLIEYGAEVNAANSVGDTPLHCAARSRNPVHKLKTLIAHGSNVNAVNGISVTPL
HLATYSDNATEALKVLIEHGAEVNSVDIYGRTPMHYISRSYSSQSLKTAVELLVEHGADI
EAKNVIGGTPLSSACNNIEYDLRLIECFIEYGADINTRDIRDETPLYSAIKYPEIVNLLM
NYSASTNITNKSNITPLESAIANCIGSAEIIVTQIILDAFRFPDIKNDAIFIRNMKTIEE
CTMLIDVKESCEYDINKMRSIKFNNMYGLDIFIRSNNINLLSSLVSNVEDIYLEPGCFLV
YGNKLRKSVYAARKRLSLLKNSISILSNITTDGYWNALPIELKYNILAMLGDNDLFNIVR
NCS
Download sequence
Identical sequences Q70GZ8 Q9J569
NP_039125.1.37955 Q70GZ8_FOWPV V162_FOWPV gi|9634832|ref|NP_039125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]