SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q719N0_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q719N0_9PICO
Domain Number 1 Region: 1872-2334
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.24e-121
Family RNA-dependent RNA-polymerase 0.0000000000000695
Further Details:      
 
Domain Number 2 Region: 27-199
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-88
Family FMDV leader protease 0.000000464
Further Details:      
 
Domain Number 3 Region: 542-919
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.37e-79
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000143
Further Details:      
 
Domain Number 4 Region: 214-497
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.59e-74
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000196
Further Details:      
 
Domain Number 5 Region: 1659-1855
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-49
Family Viral cysteine protease of trypsin fold 0.0000000245
Further Details:      
 
Domain Number 6 Region: 1110-1363
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000349
Family Nitrogenase iron protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q719N0_9PICO
Sequence length 2335
Comment AC=Q719N0; DE=SubName: Full=Polyprotein; OS=Foot-and-mouth disease virus - type SAT 2. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MKTTDCFNVLLEIIYRFRHTFKTDRKMEFTLYNGEKKTFYSRPNKHGNCWLNSLLQLFRY
VDEPLFESEYLSPENKTLDMIKQLSDYTKLDLSDGGPPALVLRLIKDCLQTGVGTSTRPS
EICVINGVVMTLADFHAGIFIKGTGHAVFALNTSEGWYAIDDEVFYPWTPDPENVLAYVP
YDQEPLDVDWQDRAGLFLRGAGHSSPVTGSQNQSGNTGSIINNYYMQQYQNSMDTQLGDN
AISGGSNEGSTDTTSTHTNNTQNNDWFSKLAQSAISGLFGALLADKKTEETTLLEDRILT
TRHGTTTSTTQSSVGITYGYADADSFRPGPNTSGLETRVEQAERFFKEKLFDWTSDKPFG
TLYVLELPKDHKGIYGSLTDAYTYMRNGWDVQVSATSTQFNGGSLLVAMVPELCSLKDRE
EFQLSLYPHQFINPRTNTTAHIQVPYLGVNRHDQGKRHQAWSLVVMVLTPLTTEAQMQSG
TVEVYANIAPTNVFVAGEKPAKQGIIPVACFDGYGGFQNTDPKTADPIYGYVYNPSRNDC
HGRYSNLLDVAEACPTFLNFDGKPYVVTKNNGDKVMTCFDVAFTHKVHKNTFLAGLADYY
AQYQGSLNYHFMYTGPTHHKAKFMVAYIPPGIETDRLPKTPEDAAHCYHSEWDTGLNSQF
TFAVPYVSASDFSYTHTDTPAMATTNGWVAVFQVTDTHSAEAAVVVSVSAGPDLEFRFPV
DPVRQTTSSGEGADVVTTDPSTHGGAVTEKKRVHTDVAFVMDRFTHVLTNRTAFAVDLMD
TNEKTLVGALLRAATYYFCDLEIACLGEHERVWWQPNGAPRTTTLRDNPMVFSHNNVTRF
AVPYTAPHRLLSTRYNGECKYTQQSTAIRGDRAVLAAKYANTKHKLPSTFNFGYVTADKP
VDVYYRMKRAELYCPRPLLPGYDHADRDRFDSPIGVKKQLCNFDLLKLAGDVESNPGPFF
FSDVRENFTKLVESINNMQQDMSTKHGPDFNRLVSAFEELTKGVKAIKDGLDEAKPWYKV
IKLLSRLSCMAAVAARSKDPVLVAIMLADTGLEILDSTFVVKKISDALSSVFHVPAPVFS
FGAPILLAGLVKVASTFFRSTPEDLERAEKQLKARDINDIFAILKNGEWLVKLILAIRDW
IKAWISSEEKYISMTDLVPRILECQHNLNDPSKYQESKEWLENAREACLKNGNHHIANLC
KVNAPAPSRSRPEPVVVCLRGKSGQGKSFLANVLAQAISTHFTGRTDSVWYCPPDPDHFD
GYNQQTVVVMDDLGQNPDGKDFKYFAQMVSTTGFIPPMASLEDKGKPFNSKVIIATSNLY
SGFTPRTMVCPDALNRRFHFDIDVSAKDGYKVNNRLDIIKALEDTHTNAPAMFNYDCALL
NGSAVEMKRLQQDVFKPLPPLNSLYQLVDEVIERVKLHEKVSSHPIFKQISIPSQKSVLY
FLIEKGQHEAAIEFYEGMVHDSIKEELKPLLEQTSFAKRAFKRLKENFEIVALVVVLLAN
IIIMIRETRKRQKMVDDALDEYIEKANITTDDKTLEEAGRNPQEVVDKPTVGFRERKLPG
HKTDDEVNSEPAKPTEKPQAEGPYAGPLERQQPLKLKAKLPQAEGPYAGPLEKQQPLKLK
ARLPVAKEGPYEGPVKKPVALKVKAKAPIVTESGCPPTDLQKMVMANVKPVELILDGKTV
ALCCATGVFGTAYLVPRHLFAEKYDKIMLDGRALTDSDFRVFEFEVKVKGQDMLSDAALM
VLHSGNRVRDLTGHFRDTMKLSKGSPVVGVVNNADVGRLIFSGDALTYKDLVVCMDGDTM
PGLFAYRAGTKVGYCGAAVLAKDGAKTVIVGTHSAGGNGVGYCSCVSRSMLLQMKAHIDP
PPHTEGLVVDTREVEERVHVMRKTKLAPTVAHGVFQPEFGPAALSNNDKRLSEGVVLDEV
IFSKHKGDAKMSEADKRLFRLCAADYASHLHNVLGTANSPLSVFEAIKGVDGLDAMEPDT
APGLPWALRGKRRGALIDFENGTVGSEIEAALKLMEKKEYKFTCQTFLKDEIRPLEKVKA
GKTRIVDVLPVEHIIYTRMMIGRFCAQMHSNNGPQIGSAVGCNPDVDWQRFGTHFAQYKN
VWDIDYSAFDANHCSDAMNIMFEEVFREEFGFHPNAVWILKTLINTEHAYENKRITVEGG
MPSGCSATSIINTILNNIYVLYALRRHYEGVELSHYTMISYGDDIVVASDYDLDFEALKP
HFKSLGQTITPADKSDKGFVLGQSITDVTFLKRHFHLDYETGFYKPVMASKTLEAILSFA
RRGTIQEKLISVAGLAVHSGQDEYRRLFEPFQGTFEIPSYRSLYLRWVNAVCGDA
Download sequence
Identical sequences Q719N0
Q719N0_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]