SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q769M0_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q769M0_9CALI
Domain Number 1 Region: 25-94
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.14e-20
Family Caliciviridae-like VP 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q769M0_9CALI
Sequence length 94
Comment AC=Q769M0; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Human norovirus Saitama. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDAAPSNDGAAGLVPEINNEAMPLDPVAGAAIAAPLTGQQNIIDPWIMNNFVQAP
GGEFTVSPRNSPGEVLLNLELGPEINPYLAHLAR
Download sequence
Identical sequences Q769M0
Q769M0_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]