SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q80B24_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q80B24_9PICO
Domain Number 1 Region: 1869-2331
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 2.72e-124
Family RNA-dependent RNA-polymerase 0.000000000000029
Further Details:      
 
Domain Number 2 Region: 29-200
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.98e-88
Family FMDV leader protease 0.0000000186
Further Details:      
 
Domain Number 3 Region: 216-498
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.46e-80
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000099
Further Details:      
 
Domain Number 4 Region: 540-917
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.91e-78
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000924
Further Details:      
 
Domain Number 5 Region: 1656-1852
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.66e-52
Family Viral cysteine protease of trypsin fold 0.0000000108
Further Details:      
 
Domain Number 6 Region: 1106-1341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000964
Family Nitrogenase iron protein-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q80B24_9PICO
Sequence length 2332
Comment AC=Q80B24; DE=SubName: Full=Polyprotein; OS=Foot-and-mouth disease virus - type O. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MSTTDCFIALLYAFREIKTLFLSRAQGKMEFTLHNGERKTFYSRPNNHDNCWLNTILQLF
RYVDEPFFDWVYYSPENLTLDAIKQLEEITGLELHEGGPPALVIWNIKHLLNTGIGTASR
PSEVCMVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVF
VPYDQEPLNGEWKAKVQKRLRGAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLG
DNAISGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFSGLFGALLADKKTEETTLLEDRI
LTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWVTSDP
FGRYYLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSIDK
RELYQLTLFPHQFINPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTVNTEGA
PQIKVYANIAPTNVHVAGEFPSKEGIFPVACSDGYGGLVTTDPKTADPAYGKVFNPPRNM
LPGRFTNFLDVAEACPTFLHFEGDVPYVTTKTDSDRVLAQFDLSLAAKHMSNTFLAGLAQ
YYTQYSGTINLHFMFTGPTDAKARYMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFT
FSIPYLSAADYAYTASDVAETTNVQGWVCLFQITHGKADGDALVVLASAGKDFELRLPVD
ARTQTTSTGESADPVTATVENYGGETQVQRRQHTDVSFILDRFVKVTPKDQINVLDLVQT
PAHTLVGALLRTATYYFADLEVAVKHEGNLTWVPNGAPETALDNTTNPTAYHKAPLTRLA
LPYTAPHRVLATVYNGNCKYGESPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTEL
LYRMKRAETYCPRPLLAIHPSEARHKQKIVAPVKQLLNFNLLKLAGDVESNPGPFFFSDV
RSNFSKLVETINQMQEDMSTKHGPDFNRLVSAFEELATGVKAIRTGLDEAKPWYKLIKLL
SRLSCMAAVAARSKDPVLVAIMLADTGLEILDSTFVVKKISDSLSSLFHVPAPVFSFGAP
ILLAGLVKVASSFFRSTPEDLERAEKQLKARDINDIFAILKNGEWLVKLILAIRDWIKAW
IASEEKFVTMTDLVPGILEKQRDLNDPSKYKEAKEWLDNARQACLKSGNIHIANLCKVVA
PAPSRSRPEPVVVCLRGKSGQGKSFLANVLAQAISTHFTGRTDSVWYCPPDPDHFDGYNQ
QTVVVMDDLGQNPDGKDFKYFAQMVSTTGFIPPMASLEDKGKPFNSKVIIATTNLYSGFT
PRTMVCPDALNRRFHFDIDVSAKDGYKINNKLDIIKALEDTHTNPVAMFQYDCALLNGMA
VEMKRVQQDVFKPQPPLQNVYQLVQEVIDRVELHEKVSSHPIFKQISIPSQKAVLYFLIE
KGQHEAAIEFFEGMVHDSIKEELRPLIQQTSFVKRAFKRLKENFEIVALCLTLLANIVIM
IRETRKRQQMVDDAVNEYIEKASITTDDKTLDEAEKNPLETSGATTVGFREKTLPGHKAS
DDVNSEPAKPVEEQPQAEGPYTGPLERQKPLKVRAKLPQQEGPYAGPMERQKPLKVKVKA
PVVKEGPYEGPVKKPVALKVKAKNLIVTESGAPPTDLQKMVMGNTKPVELILDGKTVAIC
CATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLH
RGNRVRDITKHFRDVARMKKGTPVVGVINNADVGRLIFSGEALTYKDIVVCMDGDTMPGL
FAYKAATKAGYCGGAVLAKDGAETFIVGTHSAGGNGVGYCSCVSRSMLLKMKAHIDPEPH
HEGLIVDTRDVEERVHVMRKTKLAPTVAHGVFNPEFGPAALSNKDPRLNEGVVLDEAIFS
KHKGNTKMSEEDKALFRRCAADYASRLHSVLGTANAPLSTYEAIKGVDGLDAMEPDTAPG
LPWALQGKRRGALIDFENGTVGPEVEAALKLMEKREYKFVCQTFLKDEIRPMEKVRAGKT
RIVDVLPVEHILYTRMMIGRFCAQMHLNNGPQIGSAVGCNPDVDWQRFGTHFAQYRNVWD
VDYSAFDANHCSDAMNIMFEEVFNTDFGFHPNAEWILKTLVNTEHAYENKRITVEGGMPS
GCSATSIINTILNNIYVLYALRRHYEGVELDSYTMISYGDDIVVASDYDLDFEALRPHFK
SLGQTITPADKSDKGFVLGHSITDVTFLKRHFHMDYGTGFYKPVMASKTLEAILSFARRG
TIQEKLISVAGLAIHSGPDEYRRLFEPFQGLFEIPSYRSLYLRWVNAVCGDA
Download sequence
Identical sequences Q80B24
Q80B24_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]