SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q80IV2_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q80IV2_9PICO
Domain Number 1 Region: 1849-2306
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.42e-115
Family RNA-dependent RNA-polymerase 0.0000000371
Further Details:      
 
Domain Number 2 Region: 77-410
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 7.02e-106
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000231
Further Details:      
 
Domain Number 3 Region: 450-906
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 9.97e-84
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000000317
Further Details:      
 
Domain Number 4 Region: 1645-1835
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.57e-45
Family Viral cysteine protease of trypsin fold 0.005
Further Details:      
 
Weak hits

Sequence:  Q80IV2_9PICO
Domain Number - Region: 1277-1439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000141
Family RecA protein-like (ATPase-domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q80IV2_9PICO
Sequence length 2307
Comment AC=Q80IV2; DE=SubName: Full=Polyprotein; GN=Name=L; OS=Theiler's-like virus of rats. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Cardiovirus.
Sequence
MMACIHGYPSVCPICTAIDKSSDGMYLLLADNEWFPADLLTMDLDDDVFWPNDESDVSET
MDWTDLPFILDTIMEPQGNSTSSDKSNSQSSGNEGVIINNFYSNQYQNSIDLSANGGNAG
GAPKTEGQLGNILGNAANAFSTMAPLLLDQNTEEMENLSDRVDSDKAGNSAVNTQSSVGR
LCGYGMHHKGKHPASCADTATDKVLSAERYYTIDLATWTTTLGTFSHIRIPLPHVLAGED
GGVFGSTLRRHYLCKCGWRIQVQCNASQFHAGSLLVFMAPEFYTGHTPVTGTTEPATPFT
MDSSWQTPQQNPVGFRYDGRTGYFALNHQNYWQWMVYPHQILNLRTNTSVDLEVPFTNIA
PTSSWTQHANWTLVVAVLTPLQYAAGSATDVQITASIQPVKPVFNGLRHEAVVPQSPIPV
TVREHQGTFYSTNPDTTVPIYGKTIATPSDYMCGEFSDLVELCKLPTFLGNPANTSPAGG
RYPYFSATNSVPATALASYQVALSCSCMSNSMLAAVARNFNQYRGSLNFLFVFTGTAMTK
GKFLIAYTPPGAGKPTTREQAMQATYAIWDLGLNSSYNFTVPFISPTHYRQTSYTSTSIT
SVDGWLTVWQLTPLTYPANTPPNADILTLVSAGDDFTLRMPISPTKWIPQGVDNAEKGKV
SNDDATVDFVAEPVKFPDNQTKVSFFYDRSVPLGLLRPAQGMEQDFAYAANDSRANSILL
TPLPSYAPDSTTGPTETQAPIQWRWLRGTSDGSTTFPLMTKQDYAFLLFSPFTYYKADLE
VTLSAISNSNNVTVVRWAPTGAPADISRQLSGYTPSIGDTRDPHLWFVGAGNSQTSFVVP
YNSPLSVLPAAWFNGWSDFGNTKDFGVAPNADFGRLWIQGNTSVAVRVRYKKMKVFCPRP
TLFLPWPSTTTTRIHADNPVSVMELQNPFSFYRVDLFITFTDELITFDYKVHGRPVLQYQ
VPGLGLTCAGRMLVCMGQMPNHAPFSTVRHLYHVVFTGSRNSFGVVIYYKRHRPWKKPLH
EELHDYGFECFSDFFKHVREYHAAYYKQRLMHDVETNPGPPVQSVFRPQGGVLTKSQAPM
SGIQNLFLRALGIDADHGEFTRAVTMITDLCNTWEKAKNTLVSPEFWTVLIMKTVKFIAA
SVLYLHNPDLTATICLSLMTGVDVLTNESIFNWLSNKLSKLFHTPPPPTSPLLQAQSPLR
EANDGFNLAKNIEWAIKTVQKIVDWLMSWFKQEEAHPQAKLDKMLADFPEHCASILAMRN
GRKAYTDCAGAFKYFEDLYNLAVQCKRIPLATLCEKFKNKHDHAVARPEPVVVVLRGNAG
QGKSVTSQIIAQAVSKLAFGRQSVYSIPPDSDYLDGYENQFSVIMDDLGQNPDGEDFKVF
CQMVSSTNFLPNMAHLEKKGTPFTSNFIVATTNLPKFRPVTVAHYPAVDRRITFDLTVEA
GPACKTPTGMLDVEKAFQEIPGEPQLDCFSSDCALLHKRGVQFICNRTKKIYNLQQIVKM
VKDTIDNKVANLKKMNTLVAQSPNNGNDMEHIITCLRQNNAALQDQIDELQEAFAQAQER
QNFLSDWMKVSAIIFAGIASLSAVCKLVGRLKNLIWPSPVHVELSEGEQAAYAGAKRGAK
QALQVLDLQGGGRIIAQAGNPVMDYEVCVAKNMVAPITFYYADKAQVTQSCLLVKGRLFV
VNRHVAETDWVSFELRDVRHERDTVTMRSVNRSGMEVDLTFIKVTKGPLFKDNTKKFCSN
KDDFPQKNETVTGIMNTGLPFVFNGKFIIGNHPVNTTTGATFNHCLHYRANTRRGWCGSA
VICQVNGKKAVYGMHSAGGGGLAAATIITQELVEAAEQNMDRLVPQGAIMEIGTGSVVHV
PRKTKLRRTVAHEIFLPKFEPAVLSRYDPRTEKDVDQVAFSKHTTNMEELPAVFSMVAKE
YANRVFTKLGKENQLLTTQQAILGLPGMDPMEKDTSPGLPYTQQGLRRTDLVNFETGKMD
HNLDYAHSKLMLGHYEDVVYQSFLKDEIRPIEKIHEAKTRIVDVPPFHHCIWGRQLLGRF
ASRFQTNPGLDLGSAIGTDPDVDWTVFAHQLAEFKYIYDVDYSNFDASHSTAIFEILIQE
FFTPQNGFDPRIGEYLRSLAVSRHAYEDRRVLIRGGLPSGCAATSMINTIINNIVIRAAL
YMTYANFEFDDIKVLSYGDDLLIATNYEINFNLVKERLAPFNYKITPANKTSTFPQTSHL
QDVVFLKRRFVQFNSFLFRPQMETENLKAMVSYCRPGVLKEKLMSIALLAVHSGPDVYDE
IFMPFRRIGVVVPEYSTMLYRWLNLFR
Download sequence
Identical sequences Q80IV2
Q80IV2_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]