SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q82413_HTLV2 from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q82413_HTLV2
Domain Number 1 Region: 51-132
Classification Level Classification E-value
Superfamily Virus ectodomain 3.84e-25
Family Virus ectodomain 0.00000901
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q82413_HTLV2
Sequence length 202
Comment AC=Q82413; DE=SubName: Full=Transmembrane glycoprotein gp21; Flags: Fragment; GN=Name=env; OS=Human T-cell leukemia virus 2 (HTLV-2). OC=Viruses; Retro-transcribing viruses; Retroviridae; Orthoretrovirinae; OC=Deltaretrovirus.
Sequence
CNNSIILPPFSLAPVPPPATRRRRAVPIAVWLVSALAAGTGIAGGVTGSLSLASSKSLLL
EVDKDISHLTQAIVKNHQNILRVAQYAAQNRRGLDLLFWEQGGLCKAIQEQCCFLNISNT
HVSVLQERPPLEKRVITGWGLNWDLGLSQWAREALQTGITILALLLLVILFGPCILRQIQ
ALPQRLHNRHNQYSLINPETML
Download sequence
Identical sequences Q82413 Q82414 Q82415
Q82413_HTLV2 Q82414_HTLV2 Q82415_HTLV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]