SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q88595_TMEVG from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q88595_TMEVG
Domain Number 1 Region: 1845-2302
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.17e-113
Family RNA-dependent RNA-polymerase 0.000000016
Further Details:      
 
Domain Number 2 Region: 76-409
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.27e-101
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000000000413
Further Details:      
 
Domain Number 3 Region: 449-902
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 4.05e-85
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000161
Further Details:      
 
Domain Number 4 Region: 1641-1832
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.18e-43
Family Viral cysteine protease of trypsin fold 0.0066
Further Details:      
 
Weak hits

Sequence:  Q88595_TMEVG
Domain Number - Region: 1271-1434
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000172
Family RecA protein-like (ATPase-domain) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q88595_TMEVG
Sequence length 2303
Comment AC=Q88595; DE=SubName: Full=Theilers murine encephalomyelitis virus (TMEV) complete genome; OS=Theiler's murine encephalomyelitis virus (strain GDVII) (TMEV). OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Cardiovirus.
Sequence
MACKHGYPDVCPICTAVDATPDFEYLLMADGEWFPTDLLCVDLDDDVFWPSDTSTQPQTM
EWTDVPLVCDTVMEPQGNASSSDKSNSQSSGNEGVIINNFYSNQYQNSIDLSASGGNAGD
APQNNGQLSSILGGAANAFATMAPLLMDQNTEEMENLSDRVASDKAGNSATNTQSTVGRL
CGYGKSHHGEHPTSCADAATDKVLAAERYYTIDLASWTTSQEAFSHIRIPLPHVLAGEDG
GVFGATLRRHYLCKTGWRVQVQCNASQFHAGSLLVFMAPEFYTGKGTKSGTMEPSDPFTM
DTTWRSPQSAPTGYRYDRQAGFFAMNHQNQWQWTVYPHQILNLRTNTTVDLEVPYVNVAP
SSSWTQHANWTLVVAVLSPLQYATGSSPDVQVTASLQPVNPVFNGLRHETVLAQSPIPVT
VREHQGCFYSTNPDTTVPIYGKTISTPSDYMCGEFSDLLELCKLPTFLGNPSTDNKRYPY
FSATNSVPATSLVDYQVALSCSCTANSMLAAVARNFNQYRGSLNFLFVFTGAAMVKGKFL
IAYTPPGAGKPTTRDQAMQATYAIWDLGLNSSFNFTAPFISPTHYRQTSYTSPTITSVDG
WVTVWQLTPLTYPSGTPTHSDILTLVSAGDDFTLRMPISPTKWVPQGIDNAEKGKVSNDD
ASVDFVAEPVKLPENQTRVAFFYDRAVPIGMLRPGQNMETTFSYQENDFRLNCLLLTPLP
SYCPDSSSGPVRTKAPVQWRWVRSGGANGANFPLMTKQDYAFLCFSPFTYYKCDLEVTVS
AMGAGTVSSVLRWAPTGAPADVTDQLIGYTPSLGETRNPHMWIVGSGNSQISFVVPYNSP
LSVLPAAWFNGWSDFGNTKDFGVAPTSDFGRIWIQGNSSASVRIRYKKMKVFCPRPTLFF
PWPTPTTTKINADNPVPILELENPASLYRIDLFITFTDELITFDYKVHGRPVLTFRIPGF
GLTPAGRMLVCMGEKPAHSPFTSSKSLYHVIFTSTCNSFSFTIYKGRYRSWKKPIHDELV
DRGYTTFREFFKAVRGYHADYYKQRLIHDVEMNPGPVQSVFQPQGAVLTKSLAPQAGIQN
ILLRLLGIEGDCSEVSKAITVVTDLVAAWEKAKTTLVSPEFWSELILKTTKFIAASVLYL
HNPDFTTTVCLSLMTGVDLLTNDSVFDWLKSKLSSFFRTPPPACPNVMQPQGPLREANEG
FTFAKNIEWATKTIQSIVNWLTSWFKQEEDHPQSKLDKLLMEFPDHCRNIMDMRNGRKAY
CECTASFKYFDDLYNLAVTCKRIPLASLCEKFKNRHDHSVTRPEPVVVVLRGAAGQGKSV
TSQIIAQSVSKMAFGRQSVYSMPPDSEYFDGYENQFSVIMDDLGQNPDGEDFTVFCQMVS
STNFLPNMAHLERKGTPFTSSFIVATTNLPKFRPVTVAHYPAVDRRITFDFTVTAGPHCK
TPAGMLDIEKAFDEIPGSKPQLACFSADCPLLHKRGVMFTCNRTKTVYNLQQVVKMVNDT
ITRKTENVKKMNSLVAQSPPDWQHFENILTCLRQNNAALQDQVDELQEAFTQARERSDFL
SDWLKVSAIIFAGIVSLSAVIKLASKFKESIWPTPVRVELSEGEQAAYAGRARAQKQALQ
VLDIQGGGKVLAQAGNPVMDFELFCAKNMVSPITFYYPDKAEVTQSCLLLRAHLFVVNRH
VAETEWTAFKLRDVRHERDTVVMRSVNRSGAETDLTFVKVTKGPLFKDNVNKFCSNKDDF
PARNDTVTGIMNTGLAFVYSGNFLIGNQPVNTTTGACFNHCLHYRAQTRRGWCGSAIICN
VNGKKAVYGMHSAGGGGLAAATIITRELIEAAEKSMLALEPQGAIVDISTGSVVHVPRKT
KLRRTVAHDVFQPKFEPAVLSRYDPRTDKDVDVVAFSKHTTNMESLPPIFDIVCGEYANR
VFTILGKDNGLLTVEQAVLGLSGMDPMEKDTSPGLPYTQQGLRRTDLLDFNTAKMTPQLD
YAHSKLVLGVYDDVVYQSFLKDEIRPLEKIHEAKTRIVDVPPFAHCIWGRQLLGRFASKF
QTKPGLELGSAIGTDPDVDWTRYAAELSGFNYVYDVDYSNFDASHSTAMFECLINNFFTE
QNGFDRRIAEYLRSLAVSRHAYEDRRVLIRGGLPSGCAATSMLNTIMNNVIIRAALYLTY
SNFEFDDIKVLSYGDDLLIGTNYQIDFNLVKERLAPFGYKITPANKTTTFPLTSHLQDVT
FLKRRFVRFNSYLFRPQMDAVNLKAMVSYCKPGTLKEKLMSIALLAVHSGPDIYDEIFLP
FRNVGIVVPTYDSMLYRWLSLFR
Download sequence
Identical sequences Q88595
NP_040350.1.67367 gi|9626124|ref|NP_040350.1| Q88595_TMEVG

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]