SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8QV03_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8QV03_9PICO
Domain Number 1 Region: 1738-2220
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.41e-116
Family RNA-dependent RNA-polymerase 0.00000516
Further Details:      
 
Domain Number 2 Region: 2-247
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.69e-49
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0065
Further Details:      
 
Domain Number 3 Region: 249-489
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.06e-48
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0025
Further Details:      
 
Domain Number 4 Region: 1523-1733
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.28e-43
Family Viral cysteine protease of trypsin fold 0.00000000277
Further Details:      
 
Domain Number 5 Region: 507-777
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.91e-35
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0021
Further Details:      
 
Domain Number 6 Region: 1218-1371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000544
Family Extended AAA-ATPase domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q8QV03_9PICO
Sequence length 2227
Comment AC=Q8QV03; DE=SubName: Full=Polyprotein; OS=Hepatitis A virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Hepatovirus.
Sequence
MNMAKQGIFQTVGSGLDHILSLADIEEEQMIQSVDRTAVTGASYFTSVDQSSVHTAEVGS
HQIEPLKTSVDKPGSKKTQGEKFFLIHSADWLTTHALFHEVAKLDVVKLLYNEQFAVQGL
LRYHTYARFGIEIQVQINPTPFQQGGLICAMVPGDQSYGSIASLTVYPHGLLNCNINNVV
RIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLT
PLSTQMMRNEFRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWT
SIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDL
VFDFQVFPTKYHSGRLLFCFVPGNELIDVTGITLKQATTAPCAVMDITGVQSTLRFRVPW
ISDTPYRVNRYTKSAHQKGEYTAIGKLIVYCYNRLTSPSNVASHVRVNVYLSAINLECFA
PLYHAMDVTTQVGDDSGGFSTTVSTEQNVPDPQVGITTMRDLKGKANRGKMDVSGVQAPV
GAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTF
PITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTP
WVEKESALSIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLV
SIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLSTESMMSRIAAGDLESSVD
DPRSEEDRRFESHIECRKPYKDLRLEVGKQRLKYAQEELSNEVLPPPRKMKGLFSQAKIS
LFYTEEHEIMKFSWRGVTADTRALRRFGFSMAAGRSVWTLEMDAGVLTGRLVRLNDEKWT
EMKDDKIVSLIEKFTSNKYWSKVNFPHGMLDLEEIAANSTDFPNMSETDLCFLLHWLNPK
KINLADRMLGLSGVQEIKEQGVGLIAECRTFLDSIAGTLKSMMFGFHHSVTVEIINTVLC
FVKSGILLYVIQQLNQDEHSHIIGLLRVMNYADIGCSVISCGKVFSKMLETVFNWQMDSR
MMELRTQSFSNWLRDICSGITIFKSFKDAIYWLYTKLKDFYEVNYGKKKDVLNILKDNQQ
KIEKAIEEADNFCILQIQDVEKFDQYQKGVDLIQKLRTVHSMAQVDPNLGVHLSPLRDCI
ARVHQKLKNLGSINQAMVTRCEPVVCYLYGKRGGGKSLTLIALATKICKHYGVEPEKNIY
TKPVASDYWDGYSGQLVCIIDDIGQNTTDEDWSDFCQLVSGCPMRLNMASLEEKGRHFSS
PFIIATSNWSNPSPKTVYVKEAIDRRLHFKVEVKPASFFKNPHNDMLNVNLAKTNDAIKD
MSCVDLVMDGHNISLMDLLSSLVMTVEIRKQNMSEFMELWSQGISDDDNDSAVAEFFQSF
PSGEPSNSKLSSFFQSVTNHKWVAVGAAVGILGVLVGGWFVYKHFSRKEEEPIPAEGVYH
GVIKPKQVIKLDADPVESQSTLEIAGLVRKNLVQFGVGEKNGCVRWVMNALGVKDDWLLV
PSHAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQ
HFIKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKATYVHKKNDGTTVDLTVDQAW
RGKGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNIDKKIESQRI
MKVEFTQCSMNVVSKTLFRKSPIHHHIDKTMINFPAAMPFSKAEIDPMAVMLSKYSLPIV
EEPEDYKEASVFYQNKIVGKTQLVDDFLDLDMAITGAPGIDAINMDSSSGFPYVQEKLTK
RDLIWLDENGLLLGVHPRLAQRILFNTVMMENCSDLDVVFTTCPKDELRPLEKVLESKIR
AIDACPLDYTILCRMYWGPAISYFHLNPGFHTGVAIGIDPDRQWDELFKTMIRFGDVGLD
LDFSAFDASLSPFMIREAGRIMSELSGTPSHFGTALINTIIYSKHLPYNCCYHVCGSMPS
GSPCTALLNSIVNNINLYYVFSKIFGKSPVFFCQALRILCYGDDVLIVFSRDVQIDNLDL
IGQKIVDEFKKLGMTATSADKNVPQLKPVSELTFLKRSFNLVEDRIRPAISEKTIWSLIA
WQRSNAEFEQNLENAQWFAFMHGYEFYQKFYYFVQSCLEKEMIEYRLKSYDWWRMRFYDQ
CFICDLS
Download sequence
Identical sequences Q8QV03
Q8QV03_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]