SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q8VA08_9CALI from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q8VA08_9CALI
Domain Number 1 Region: 25-149
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.93e-49
Family Caliciviridae-like VP 0.0000259
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q8VA08_9CALI
Sequence length 149
Comment AC=Q8VA08; DE=SubName: Full=Capsid protein; Flags: Fragment; OS=Human calicivirus HU/NLV/Borna 185/00/DE. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Caliciviridae; OC=Norovirus.
Sequence
MKMASNDANPSDGSTANLVPEVNNEVMALEPVVGAAIAAPVAGQQNVIDPWIRNNFVQAP
GGEFTVSPRNAPGEILWSAPLGPDLNPYLSHLARMYNGYAGGFEVQVILAGNAFTAGKII
FAAVPPNFPTEGLSPSQVTMFPHIIVDVR
Download sequence
Identical sequences Q8VA08
Q8VA08_9CALI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]