SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q91AH4_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q91AH4_9PICO
Domain Number 1 Region: 1869-2331
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.56e-122
Family RNA-dependent RNA-polymerase 0.000000000000034
Further Details:      
 
Domain Number 2 Region: 29-201
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.79e-89
Family FMDV leader protease 0.0000000166
Further Details:      
 
Domain Number 3 Region: 540-917
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 7.94e-76
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0000000109
Further Details:      
 
Domain Number 4 Region: 216-498
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 5.12e-75
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.000000000129
Further Details:      
 
Domain Number 5 Region: 1656-1852
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.45e-52
Family Viral cysteine protease of trypsin fold 0.000000011
Further Details:      
 
Domain Number 6 Region: 1108-1341
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000266
Family Nitrogenase iron protein-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q91AH4_9PICO
Sequence length 2332
Comment AC=Q91AH4; DE=SubName: Full=Polyprotein; OS=Foot-and-mouth disease virus O/SKR/2000. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Aphthovirus.
Sequence
MSTTDCFTALLYAFREIKTLLLSRVQGKMEFTLHNGEKKTFYSRPNNHDNCWLNTILQLF
RYVDEPFFDWVYYSPENLTLDAIKQLEEITGLELHEGGPPALVIWNIKHLLNTGIGTASR
PSEVCMIDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVF
VPYDQEPLNGEWKAKVQRKLRGAGQSSPATGSQNQSGNTGSIINNYYMQQYQNSMDTQLG
DNAISGGSNEGSTDTTSTHTTNTQNNDWFSKLASSAFSGLFGALLADKKTEETTLLEDRI
LTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHCYDWVTSDP
FGRCYLLELPTDHKGVYGSLTDSYAYMRNGGDVEVTAVGNQFNGGCLLVAMVPKLCSNDK
RELYQLTLFPHQFIYPRTNMTAHITVPFVGVNRYDQYKVHKPWTLVVMVVAPLTINTEGA
PQIKVYANIAPTNVHVAGEFPSKEGIFPVACSDGYGGMVTTDPKTADPAYGKVFNPPRNM
LPGWFTNFLDVAEACPTFLHFEGDVPYVTTKTDSDRVLAQFDLSLAAKHMSNTFLAGLAQ
YYTQYSGTINLHFMFTGPTDANARYMIAYAPPGMEPPKTPEAAAHCIHAEWDTGLNSKFT
FSIPYLSAADYAYTASDVAETTNVQGWVCLFQITHGKADGDALVVLSSAGKDFELRLPVD
ARTQTTSTGESADPVTATVENYGGETQVQRRQHTDVSFIIDRFVKVTPKDQINVLDLMQT
PAHTLVGALLRTATYYFADVEVAVKHEGDLTLVPNGAPETTLDNTTNPTAYHKAPLTRFA
LPYTAPHRVLATVYNGNCKYGESPVTNVRGDLQVLAQKAARTLPTSFNYGAIKATRVTEL
LYRMKRAETYCPRPLLAIHPSEARHKQKIVAPVKQLLSFDLLKLAGDVESNPGPFFFSDV
RSNFSKLVETINQMQEDMSTKHGPDFNRLVSAFEELATGVKAIRTGLDEAKPWYKLIKLL
SRLSCMAAVAARSKDPVLVAIMLADTGLEILDSTFVVKKISDSLSSLFHVPAPVFSFGAP
ILLAGLVKVASSFFRSTPEDLERAEKQLKARDINDIFAILRNGEWLVKLILAIRDWIKAW
IASEEKFVTMTDLVPGILEKQRDLNDPSKYKEAKEWLDNTRQACLKSGNIHIANLCKVVA
PAPSRSRPEPVVVCLRGKSGQGKSFLANVLAQAISTHFTGITDSVWYCPPDPDHFDGYNQ
QTVVVMDDLGHNPDGKDSKYFAQMVSTTGFIPPMASLEDKGNPFNSKVIIATTNLYSGFT
PRNMVCPDALNRRFHVDIDVSAKDGYKISNKLDIIKALEDTHTNPVAMFQYDCALLNGMA
VEMKRMQQDMFKPQPPLQKVYQLVQEAIDRVEFHEKVSSHPIFKQISIPSQKAVLYFLIE
KGQHEAAIEFFEGMVRDSVKEELRPLIQQTSFVRRVFKRLKENFEIVALCLTLMANIVIM
IRETRKRQQMVDDAVNEYIEKANITTDDKTLDEAEKNPLETSGATTVGFREKTLPGHKAS
NDVNSEPAKPVEEQPQAEGPYTGPLERQKPLKVRAKLPQQEGPYAGPMERQKPLKVKVKT
SVVKEGPYEGPVKKPVALKVKAKNLIVTESGAPPTDLQKMVMGNTKPVELILDGKTVAIC
CATGVFGTAYLVPRHLFAEKYDKIMLDGRAMTDSDYRVFEFEIKVKGQDMLSDAALMVLH
RGNRVRDITKHFRDVARMKKGTPVVGVINNADVGRLIFSGEALTYKDIVVCMDGDTMPGL
FAYKAATKAGYCGGAVLAKDGAETFIVGTHSAGGNGVGYCSCLSRSMLLKMKAHIDPEPH
HEGLIVDTRDVEERVHVMRKTKLAPTVAHGVFNPEFGPAALSNKDPRLNEGVVLDEAIFS
KHKGNTKMSEEDKALFRRCAADYASRLHSVLGTANAPLSIYEAIKGVDGLDAMEPDTAPG
LPWALQGKRRGALIDFENGTIGPEVEAALKLMEKREYKFVCQTFLKDEIRPMEKVSAGKT
RIVDVLPVEHILYTRMMIGRFCAQMHSNNGPQIGSAVGCNPDVDWQRFGTHFAQYRNVWD
VDYSAFDANHCSDAMNIMFEEVFNTDFGFHPNAEWILKTLVNTEHAYENKGISVEGGMPS
GCSATSIFNTISNNIYVLYALRRHYEGVELDSYTMISYGDDIVVASDYDLDFEAFKPHFK
SLGQTITPADKSDKGFVLGHSITDVTFLKRSFHMDYGTGFYKPVMASKTLEAILSFARRG
TIQEKLISVAGLAVHSGPDEYRRLFEPFQGLFEIPSYRSLYLRWVNAVCGDA
Download sequence
Identical sequences Q91AH4
Q91AH4_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]