SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9DJY4_9ENTO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9DJY4_9ENTO
Domain Number 1 Region: 113-235
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.1e-54
Family Viral cysteine protease of trypsin fold 0.00017
Further Details:      
 
Domain Number 2 Region: 2-116
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.56e-45
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.00000179
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Q9DJY4_9ENTO
Sequence length 235
Comment AC=Q9DJY4; DE=SubName: Full=Polyprotein; Flags: Fragment; OS=Human coxsackievirus B1. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Enterovirus; Human enterovirus B.
Sequence
TEGNAPPRMSIPFISIGNAYSCFYDGWTQFSRNGVYGINTLNNMGTLYMRHVNEAGQGPI
KSTVRIYFKPKHVKAWVPRPPRLCQYEKQKNVNFNPTGVTTSRLNITTTGAFGQQSGAVY
VGNYRIVNRHLATHNDWQNCVWEDYNRDLLVSTTTAHGCDTIARCRCTSGVYFCASKNRH
YPVIFEGPGLAEVQESEYYPKRYQSHVLLAAGFSEPGDCGGILRCEHGVIGIVTM
Download sequence
Identical sequences Q9DJY4
Q9DJY4_9ENTO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]