SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9DL32_9PICO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9DL32_9PICO
Domain Number 1 Region: 1739-2218
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 1.43e-113
Family RNA-dependent RNA-polymerase 0.00000486
Further Details:      
 
Domain Number 2 Region: 2-247
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 3.69e-49
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0057
Further Details:      
 
Domain Number 3 Region: 250-489
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 1.65e-48
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0023
Further Details:      
 
Domain Number 4 Region: 1521-1731
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.66e-42
Family Viral cysteine protease of trypsin fold 0.00000000289
Further Details:      
 
Domain Number 5 Region: 507-777
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 2.91e-35
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.0024
Further Details:      
 
Domain Number 6 Region: 1089-1354
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000319
Family Phosphoribulokinase/pantothenate kinase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Q9DL32_9PICO
Sequence length 2225
Comment AC=Q9DL32; DE=SubName: Full=Polyprotein; OS=Hepatitis A virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Picornaviridae; Hepatovirus.
Sequence
MNMSRQGIFQTVGSGLDHILSLADIEEEQMIQSVDRTAVTGASYFTSVDRSSVHTAEVGS
HQVEPLRTSVDKPGSKKTQGEKFFLIHSADWLTTHALFHEVVKLDVVKLLYNEQFAVQGL
LRYHTYARFGIEIQVQINPTPFQQGGLICAMVPGEQSYGSMASLTVYPHGLLNCNINNVV
RIKVPFIYTRGAYHFKDPQYPVWELTIRVWSELNIGTGTSAYTSLNVLARFTDLELHGLT
PLSTQMMRNEFRVSTTENVVNLSNYEDARAKMSFALDQEDWKSDPSQGGGIKITHFTTWT
SIPTLAAQFPFNASDSVGQQIKVIPVDPYFFQMTNTNPDQKCITALASICQMFCFWRGDL
VFDFQVFPTKYHSGRLLFCFVPGNELIDVSGITLKQATTAPCAVMDITGVQSTLRFRVPW
ISDTPYRVNRYTKSAHQKGEYTAIGKLIVYCYNRLTSPSNVASHVRVNVYLSAINLECFA
PLYHAMDVTTQVGDDSGGFSTTVSTEQNVPDPQVGITTMKDLKGKANRGKMDVSGVQAPV
GAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNKEYTF
PITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTP
WVEKESALSIDYKTALGAVRFNTRRTGNIQIRLPWYSYLYAVSGALDGLGDKTDSTFGLV
SIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLSTESMMSRIAAGDLESSVD
DPRSEEDKRFESHIECRKPYKELRLEVGKQRLKYAQEELSNEVLPPPRKMKGLFSQAKIS
LFYTEEHEIMKFSWRGVTADTRALRRFGFSLAAGRSVWTLEMDAGVLTGRLIRLNDEKWT
EMKDDKIVSLIEKFTSNKYWSKVNFPHGMLDLEEIAANSKDFPNMSETDLCFLLHWLNPK
KINLADRMLGLSGVQEIKEQGVGLIAECRTFLDSIAGALKSMMFGFHHSVTVEIINTVLC
FVKSGILLYVIQQLNQDEHSHIIGLVRVMNYVDIGCSVISCGKVFSKMLETVFNWQMDSR
MMELRTQSFSNWLRDICSGITIFKNFKDAIYWLYTKLKDFYEVNYGKKKDILNILKDNQQ
KIEKAIEEADKFCILQIQDVEKFEQYQKGVDLIQKLRTVHSMAQVDPNLMVHLSPLRDCI
ARVHQKLKNLGSINQAMVTRCEPVVCYLYGKRGGGKSLTSIALATKICKHYGVVPEKNIY
TKPVASDYWDGYSGQLVCIIDDIGQNTTDEDWSDFCQLVSGCPMRLNMASLEEKGRHFSS
PFIIATSNWSNPSPKTVYVKEAIDRRLHFKVEVEPASFFKNPHNDMLNVNLAKTSDAIKD
MSCVDLIMDGHNVSLMDLLSSLVMTVEIRKQNMTEFMELWSQGISDDDSAVAEFFQSFPS
GEPSNSKLSGFFQSVSNHKWVAVGAAVGILGVLVGGWFVYKHFSRKEEEPIPTEGVYYGV
TKPKQVIKLDADPVESQSTLEIAGLVRKNLVQFGVGEKNGCVRWVMNALGVKDDWLLVPS
HAYKFEKDYEMMEFYFNRGGTYYSISAGNVVIQSLDVGFQDVVLMKVPTIPKFRDITQHF
IKKGDVPRALNRLATLVTTVNGTPMLISEGPLKMEEKASYVHKKNDGTTVDLTVDQAWRG
KGEGLPGMCGGALVSSNQSIQNAILGIHVAGGNSILVAKLVTQEMFQNIDKKIESQRIMK
VDFTQCSMNVVSKTLFRKSPIHHHIDKTMINFPAAMPFSKAEIDPMAMMLSKYSLPIVEE
PEDYKEASIFYQNKIVGKTQLVDDFLDLDMAITGAPGIDAINMDSSPGFPYVQERLTKRD
LIWLDENGLLLGIHPRLAQRILFNTVMMENCSDLDVVFTTCPKDELRPLEKVLESKTRAI
DACPLDYTILCRMYWGPAISYFHLNPGFHTGVAIGIDPDKQWDELFKTMIRFGDVGLDLD
FSAFDASLSPFMIREAGRIMSELSGTPSHFGTALINTIIYSKHLLYNCCYHVCGSMPSGS
PCTALLNSITNNVNSYYVFSKIFGKSPVFFCQALKILRYGDDVLIVFSRGVQIDNLDLIG
QKIVDEFKKLGMTATSADKNVPQLKPVSELTFLKRSFNLVEDRIRPAISEKTIWSLIAWQ
RSNAEFEQNLENAQWFAFMHGYEFYQKFYYFVQSCLEKEMIEYRLKSYDWWRMRFYDQCF
ICDLS
Download sequence
Identical sequences Q9DL32
Q9DL32_9PICO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]