SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Q9INP5_9SECO from UniProt viral sequences

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Q9INP5_9SECO
Domain Number 1 Region: 13-167
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 7.68e-30
Family Picornaviridae-like VP (VP1, VP2, VP3 and VP4) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Q9INP5_9SECO
Sequence length 169
Comment AC=Q9INP5; DE=SubName: Full=Coat protein 2; Flags: Fragment; GN=Name=CP2; OS=Rice tungro spherical virus. OC=Viruses; ssRNA positive-strand viruses, no DNA stage; Picornavirales; OC=Secoviridae; Waikavirus.
Sequence
SGGFEESQDLGDLQAIIATGKWSTTSDKNLMEIIVHPTACYVSEKLIYQTNLSVVAHMFA
KWSGSMRYTFVFGASMFDRGKIMVSAVPVQFRNSKLTLSQMAAFPSMVCDLSVETREFTF
EVPYISIGKMSLVCKDYLFDISSYNADLVVSRLHVMILDPXVKTGNASH
Download sequence
Identical sequences Q9INP5
Q9INP5_9SECO

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]